`z;0*o m$m,B"HJgP"&J$YJf"Jg< Af Rf Gf Vf =f Jg#4 B "&J$YJf"Jf&f2B "40EHB2 r ggSJ"g fB*`B" 42#42.I+I/ #N?|BWN>NXON" ?N?<LNANVN0lHycN6~XON 20.3I"3j~# Ib n #GB9͈N 0lHyuN6~XOpd?HyHN:\O/9$HycNPO3"n3,36P09ngLBgBgHynHycN 0l.HycHyБNPOBynHyШHycNPON #?<#Z?<#ZN XO0lHyЭN6~XOB9JN<4NKVHyPNXO0gN<"p?BgNJXO`0N} y6o BgNJTO͈9͈gNT` no8"n i -g* n /(NXO o n /(HyJNPO9Jg:HyJN XO y6o"p?NJTO͈9͈gNT`B9J no*NQ͈B@9͈͊09rgN|9͈gf09Rg09*HH?NTONKVHyPNXO0gN<"`NT09lfHyNXXO09tgN| 9̈́gZ/9̈́HyNPO=@ no:B?.N\O yo"p?NJTO͈9͈gNT`09rf09tf9͊g09f?9f0. yBfB@`3.09.gp`0<30#>3 B09RgHp //.NPO=@?.N TO=@0. H/Hy>Hy0p?NK`BnBy<0.N^NuNV09LH/HyJHy?p?NK09f0. yBf094yTfB@`z09Rg&p //.NPO=@?.N TO=@`Bn#>3 B3T4By<09f0.`0.mp?p?p?p?09Bgp?`Bg?.p?NNp /0.H/NTPO#>`0.D@`lp=@`zp `p `p `p`p`p`p`p`p`Bn`NpN^NuNV >f 9>N^NuNVp?p?NMXO gp?p?NMXO`B@N^NuNV#4/.p$?N\O#4N^NuNVB4/94p$?N\ON^NuNVp /N /NPO=@p?N TO/9HNXO=@0<H =@0.no=n0<H ?/9HN \Opd?NTO?.N TOB@N^NuNVp?p?NMXO gp`B@N^NuNVH09.gp`0<300.H/Hy~Hyvp?NK-n p?p?NMXO g.0.Sn0g"&nR690Hp?p?NMXO` nB . LN^NuNV=n 0.Sn0g nRH?p?p?NM\O`0. N^NuNVn09Llp`?.p?p?NM\OB@N^NuNV09Llp`0. H/Hy҉Hyp?NK0.H/HyҕHyҊp?NKBn09.gp`0<30 nB0.lBnBNXO/0.Hї -@Bn0.n lJ0.gp?p?NMXO fp?p?NMXO g2BgNTOX @f 94gB9Xp$? y4NTOBNXOcBHyңHyҖp?NK0.H//.HyҤp?NK`p?p?NMXO=@0.@ @f&Rn0. @oHyҪHy3N POp`\Bn0.@nf*p0./HyHyҲp?NK nB` nR0.y0Rn`0.N^NuNV/09Llp`09.gp`0<300.lBnBNXO/0.Hї -@0.gfp?p?NMXO fVp?p?NMXO g2BgNTOX @f 94gB9Xp$? y4NTOBNXOc`V690Hp?p?NMXO&N^NuNV?.?9LN RXON^NuNV?<NTON^NuNV?<NTON^NuNV0.H/NNXON^NuNVBNXO#4N^NuNVBNXO4=@0.H/HyHyp?NK0.lB@`0.N^NuNVBNXO-@HnNdXO n N^NuNVB@N^NuNVBgN2TO0g0.4p3FB@N^NuNVBgN2TO0g.BHyHyp?NK0.4p3FB@N^NuNVBHyHyp?NKBgN2TO0g"BHyHyp?NKByFB@N^NuNVHy3|?. y3N\OHy3|NXON^NuNV0.Sn0g Hy3| n R H? y3N\O`Hy3|NXON^NuNVHy3|/.N POHy3|NXON^NuNVBn0.H @ Pg0.H @/NXORn`N^NuNVHy3|/.N POHy3|HyN PON^NuNV09Rgp?p?NMXO gp`p?p?NMXO fB@N^NuNV0.lBnBNXO/0.Hї -@9Xg9XH@@B9X`09Rg>0.g$p?p?NMXO fBNXOcp`vp?p?NMXO`:0.g"p?p?NMXO fBNXOc`p?p?NMXO@ .f 94gp$? y4NTOB@.N^NuNV34094H/HyHyp?NK094N^NuNVpN^NuNVpN^NuNVBgNTON^NuNV/ 0.H//. Hyp?NK0.HA,/HyHyp?NK?.NhTO0fBykd nf$B/. Hyp?NKB94` nfRBgN2TO0g4Hy,Hy3N POBHyvHyGp?NK`#3b4p`0.HG,Hyw/. NPO&0.HA,//. Hyzp?NK0.HA, fHyԂNzXO0.HA, fvB@&_N^NuNV/ 0.H//. Hyԉp?NK .gh n0(H/HyԠHyԐp?NK n0(H/HyԱHyԡp?NK n0(H/HyHyԲp`BHyHyp?NK ng,0.HA,/HyHyp?NK?.NhTO0f|0.g nfX#3|8 ng00.HA, H/HyHyp?NKByoT#dIfp`HyHnNPO .g n hfHyHnNPO nfHyHnNPO0.HG,Hn/. NPO&0.HA, fHyNzXO`$ nfB0.HA,/NPOByoT#dIf ng,0.HA,/HyHy p?NK0.HA, fB@&_N^NuNV?.NhTO @lB@` nf09oTo N`=@`BnBn 9Lg?.N&TTO=@``0.HA, 3|g60.HA, 3bg0.HA,/N:XO=@0.HA,Bp#\ nfp`0.mpN^NuNV nf6Sykdm yIVRIVB@@`N=@ n 00.`R0.HA,/0.HA, P hNXO=@ nfp`p.@@ n 0B@N^NuNVBn?.NhTO @lp`rp=@0.Sn0gV=nHn?.N\O0lp=@`4 n g n f n g n R p 0. n R ` n B0.N^NuNVBy:/94?<p?/9dN| 3kd09kdfh y4(H@=@09:H/Hy!Hyp?NK0.H/Hy1Hy"p?NK0.gp`(p`$#dIVSykd yIVRIVB@@N^NuNV?.NhTO @lp`&0.HA,//. N PO @gB@N^NuNV0.HA,//. N PO @fp`(0.HA,/Hy2N PO @gB@N^NuNV?./. 0.HA, P(H?NPOnf0.`pN^NuNV/>. GfN0HA,/?. 0HA, P hN\O @ff0HC, Q(gNp`L0HA,/?. 0HA, P hN\O @f0HC, Q(fB@.N^NuNV#dIf09oTH/HyCHy4p?NK09oTfB@`/98NXO?9oT/9d y8(H?NPO=@yoTf,09oTH/HyVHyDp?NKByoT`09:H/HylHyWp?NK0.H/HyՄHymp?NK` 09oTlHByoTpN^NuNV0. @ b*H0@ PN0.HA, fB@`Bp`>0.H/HyեHyՅp?NK?.HyզHy3N pN^NuNVHn/.NLPO=@0.l(09:H//.Hyp?NKp`0.@g&0.H//.Hyp?NKp`0.H//.Hyp?NKp?/.Nt\O=@l$0.H//.Hyp?NKp`X#\p ?/.Hy4N 09^H//.Hyp?NK \o 9\`BN^NuNV .fp` n!|[@ nBhD n!|\F np1@J n!|]L nBhP n!|`R nBhV n!|aX n!y\\B@N^NuNVB97lHn/.NLPO0g$B/.Hybp?NK <u`HnNXO-@ n=h ndlnl0.m n'o$B/.Hyvp?NK <׉`& n0(m n h o <׊` n0(m n ho <׋` n0(m n ho <׌` n0(m n h;o <׍` n=P0.m n;oBn?. n?( n?( n?( n0(R@??.Hy׎Hy7lNHy7lNXO=@0.H/Hy7lHyתp?NK noB97} <7lN^NuNVp=@B/.Hyױp?NK n 0( g< n h f0"n i ( f "n i (: f"n i (:g. n 0( H/ n /( Hy׸p?NKp`F n 0( H/ n /( Hyp?NKBn nlB$n 2n H0@.}f n 0( H/ n /( Hy`~Rn` n 0( H/ n /( Hyp?NKRn nld$n 2n H0@.}g"$n 0.R@2@ H0@.}f n 0( H/ n /( Hy`Vn` n 0( H/ n /( Hyp?NKB.Bn nl N$n 2n QRn`BHnHy-p?NKHnNtXO=@0.H/HnHy9p?NK0.HH@0f0.HdH@0f0.HH@0fp`B@=@Hym0.@H/NTPO-@4.BAH…2.AmHd0.@HABHѮB.p=@ nl"n 0n P"n 0.R@0@ PHnNtXO=@BHnHyEp?NK0.Y@ @ bhH0@ PN`X nm n o n 0( H/ n /( Hy\` 0.HAb0HѮ0.g noRTn`. nm no n 0( H/ n /( Hyo`HyQ ./0.Hї S/NTPO-@Rn`0.m no n 0( H/ n /( Hy؂`RHy0.H/NTPOѮ`0.m n;o n 0( H/ n /( Hyؕ` 29-H 9-Ѯp. yJRJ yJBB@.N^NuNV/>.?NTOB@.N^NuNV/>.0yhH?p?NXO0l*p3xp/HyXHy.p?NKp`B@.N^NuNVS90. y9N^NuNVH0*n(n 09vf09xf09zg gy̚fN09̜gF y9R9B@@@@3̘09̘Hѹ[f y9R9B@@>09۲g0<`B@809̐g*y̎f" Dp=@ y9R9B@@>`BnBA90Af y9R9B@@>0@< F@e F_c F?f 0 @@@>09̾gj09۲g 0F@G@`0D:09۴fB09۲g0.f4 Ef p3۴` Ef p3۲` EfBy۲`By۴D09̘fp3̘09^RJSy̘`yh09̘o0HH?NTO0mRJSy̘`B@L0N^NuNV ykdm6np=@ nl" yIVH@ngB@`Rn`pN^NuNVH8B@99B@990.[@=@ n\o n`lp\=@ n\o09̸fp\=@0.y̌=@ n\oWn y9f09oVfBJBy9B9۶09oVg@ y8R8fp39ByY&BHynHyYp?NK`ZSykdm yIVRIVH@`N:lNp39ByY& Ef(BHy܃Hyop?NKp3v`BHyܗHy܄`zRJB@H@B@H@/HyܨHyܘp?NK09h09hH/HyܶHyܩp?NKB@H@B@H@/HyHyܷp?NK*y -|۶ ngRR`B9۶ y9f  3Y&`&By̘ y9o09oVg y8R8H:fPp39`FSykdm yIVRIVH@`N:lp39 Efp3v`RJ0yh(MB.B@@@@@09̜gjBAB@Af(099f Ry̘09̘ @^m8 y^̘f8` y̘o,Ry̘09̘@ @@09̘Hѹ[fBy̘B@@8gZ09̾gH09۲fB#J|#Z. y.gp#F/9FHyPHyCp?NKBypByjBynBylByrByvBytN^NuNVBZ3f 9f"?<N TO#fHyQN6~XO yB09H/Hy{Hyop?NKB/9͌Hy|p?NKB/9͐Hy݈p?NK09fl 9͐g y͐g#͐͌#ݕ͐` #ݖ͌/9͌/9NPO#Y#ݜY"#Ydp309l 9͌` yd -@Ne=@B0.H/HyݩHyݝp?NK0.Z@ @bfH0@H PN`V-|ݪ`L-|`B-|`8-|`.HyON:XO0g <` < -@`-|09H/Hy7Hy+p?NKBHyOHy8p?NKBHy8HyEp?NK nlV09pg/.NLXO`/.BBgp ?NEj B/./.p?NO&?9YNTOB@`|09nf09pf?9,N&TO?9YNTOpS?NKTOHnNXOB/.HyRp?NO&BHyOHyep?NKpN^NuNV09H/Hy{Hynp?NK09HAZ8=P0.H/HyބHy|p?NK0.l<093Jx?NTO=@0.H/HyޓHyޅp?NKN NYh-@/./.NXO??9?.Nv N^NuNV=yY0.H/HyޝHyޔp?NK no ?.NTOBgN2TON^NuNVBy۲#JBgHyH/HnHyp?NK09> @b H0@` PN`2BHyHyp`HnHnN)|POBHnHyp?NKB/.Hyp?NK/.HnN+PO0lBHnHy p?NKB@`8p3z09zH/Hy-Hy`tHnHnN)|PO/.HnNPOBHnHy.p?NKBHyMHy<`BHy\HyN`09>H/HyyHy]p?NKBHnHyzp?NKHnBBgp?NEj Hn/.NPOHnHyhNPOB/.Hy߈p?NKBJNB3FRZ/9ZNAxXOpN^NuNV09>H//.Hyߒp?NK09zH/Hy߫Hyߞp?NKp3By۲09zg(BHy߼Hy߬p?NKByzB@`09vf yYl Dfp`B@3v09vf09xgB@`p309vf09xgp?`BgNTO=@0.lBy09g09̬gBg/. /.N/. 09fy< n 0(8g n -h: nRP .MfhHyO/.N5PO=@0.lByBHyOHy߽p?NO&B/.Hyp?NO&HyON \XO`~ .PfvHyO/.N5PO=@0.lByBHyOHyp?NO&B/.Hyp?NO&HyON \XO0g 0.fp=@0.H/HyHyp?NKB9O0.N^NuNVByzB@3x3vNN^NuNVBy۲N0lB@`|0.f y͐g$?</9͐HnN #͐`409\gHnHyON!PO`?<HyOHnN BHyOHyp?NKBHnHyp?NKHyONXO0gHA-H`$BHy8Hyp?NK-|8/.N;XOHyM=?9Y&?90.gpX`pF?Nv 0.f09RgTHyO09H/pF?p?NEj HnBBgp?NEj Hy/9FBgp?NEj BHyOHyp?NO&BHnHy p?NO&09^g09^H/HyHyp`DBHy*Hyp`2Hy809H/pX?p?NEj BHy8Hy+p?NO&RZ 9Z/NAxXOp39BJNB3F09FH/HyEHy9p?NKpN^NuNV099H/HyYHyFp?NK099 H/HyaHyZp?NK y9fBy9 099 g809JxH/HyxHybp?NK09Jxyf`09ZH/HyHyyp?NK=yZ0.oB0.H/HyHyp?NKN=@09H/HyHyp?NK0.lB@`09vf09xg: ydop39 09vH/HyHyp?NK`p??9RN?XO=@0.f.09yJxg|p39 099 H/HyHy`/9 ?.?9pD?Nv N =@0.H/HyHyp?NK0.gp` Sn`pN^NuNVBy۲ .gJ ngB/.p??9pZ?Nv yBHyHyp?NO&BHyHyp?NKp`(p-@ .l09fo09H/HyHyp?NK09Sy0o ydXd/HyONPO09H/HyOHyp?NK09fpHyON'XO=@0.H/HyHyp?NK nfHyON(XO`r0.f p=@`0.lp`*p3f09flFHyON(XO=@0.H/HyOHyp?NK0.f p3f`09fgXHyONXO-@0.=@ fXBHyOHyp?NK/.Hy-HyOp?NO&HyOBp?p?NEj `. .m&#F`B9OB@`.09H/HyHyp?NKB9O0.N^NuNVByp3X/9@Hy8NPOp39p3oV#J809^g3^`By^NHN^NuNV nH@ @R@0@B .R-@B/.Hy>p?NO&/.N"XO0grN$-@B/.HyTp?NK/.N;XOHyM=N4XO/.BBgp?NEj B/.HyXp?NO&p`6B/.Hymp?NKB/.Hyxp?NO&B@N^NuNV .g ng-|8 ng nR"nR` nR"n R fBHy8Hyp?NKHy8p?N%`\O0oVBHy8Hyp?NKByfByp3Z3X09^g3^`By^NH`BHy8Hyp?NKB@N^NuNV nRH@ @=@0.HЮ-@ nRB/.NtXO=@0.H//.Hyp?NKB/.Hyp?NK0. |2<#`XHXW PN`X/.NtXO3̪p`@/.NtXO33`/.NtXO33`/.NtXO33`/.NtXO33`/.NtXO33`x/.NtXO33`\/.NtXO33`@/.NtXO33`$/.NtXO3^`/.NtXO2pA3\`/.NtXO=@0.fp3j nfByj3>`/.NtXO3|`/.NtXO3`/.NtXO3`x/.NtXO3`b/.NtXO3`L/.NtXO3`6/.NtXO=@ nlH0.o@3̈`/.NtXO3\3Z y#@\o3#@\ y^Zop^3Z?9?9d?9\Nn\O3\`/.NtXO=@ no nl?9̂?.N~XO3~`h/.NtXO=@ no n_l3b`8/.NtXO=@0.mb3z`/.NtXO=@0.fp=@ nl nn*3fp3̰` n Bf p3̈`B@N^NuNV0.H/HyHyp?NK0. H/HyHyp?NK0. H/HyHyp?NK0.\@ n o0. H ]@=@0.H/HyHyp?NK0.N^NuNVBnB@9͈H@B@H@/HyHy p?NK09̀H/Hy"Hyp?NK09H/Hy+Hy#BgNK9͈g B@9͈=@B9͈By0.`09̀g, ydo09JxHAY=P09JxH/Hy3Hy,p?NK09JxHAY0H/HyDHy4p?NK no0. @|0(yJxfz3Jxj09jH/HyeHyEp?NKN60. @|#Yl/9YlNXO3d0. @|=h ` N:=@0.H//9YlHyfp?NK nef,0.H/HyHyqBgNKN:=@` nlpq` x0.lNBHyHyp?NKN6HyNLXOHy/9cNPOpE=@` N6N>0lHyNLXOHy` nEf(09̀H/HyHyp?NK` j nQfRyrRy09JxydH@H@=@0.H/Hy Hyp?NKBn=yJx0.ng0.H/HyHy p?NK0.HAY Po0.R@H@H@=@`0.H/Hy'Hyp?NK0.HAZ8=P0.m0. @x0(f0.H/Hy0l,HyNLXOHy/9cNPOpE=@`. nEf09̀H/HyHy`. nQf>RyrRy?9JxN2TO=@0.lpE=@/9cNLXO`b nTfRyjRy09JxH/HyHyp?NK09JxH/Hy.Hyp?NK?9JxN2TO0l&09bH/HyKHy/p?NK/9cNLXO`?9d?9Jx?9jN\O=@09jH/Hy[HyLp?NK09JxH/HymHy\p?NK0.H/HyHynp?NK nYf0.f09jHAZ8=P no0. @xRh09jHAGRP?9jN(TO?9jNDTO09jyJxfD09JxHAGBP09JxR@H@H@3Jx09JxH/HyHy`09jH/HyHy`09jH/HyHyp?NK` nNfRy09jH/HyHyp?NK?9jN(TO0.fjBHyHyp?NK09jHAZ8=PBn0.m no0. @x h g?9j`09R@H@H@yjf ydo(09jH/HyHyp?NK`09jH/Hy2Hyp?NK09jfp?`09jS@=@0.f ySg yIf BgN2`0.HAZ80=@ @o&0.HAGRP0. @xRhpY`0.o09jH/HyFHy3p?NKpE=@HyGNLXOHyY/9cNPO`*09jyJxfR0.H/HyHylBg` ydf"BHyHyp?NKN 09̀fNV0.H/HyHyBgNK0.3N^NuNVH>.09f 0@@`\0@<09 |p2<`XHXW PN`8?Bg _ B@`&0@`?Bg _ B@ @`p@LN^NuNV0.H/HyHyp?NK0. H/HyHyp?NK0. fl09TH/HyHyp?NK09\H/HyHyp?NKN # 9o092fp //9NPO-@ .oHn0.H/NLPO-@p //.NPO09TH-@09\yTo 09\H-@/.HyHyp?NK .ljHn/.NPO=@0.H =@ nlp=@0.n0.no=n0.H/HyHyp?NK0.N^NuNVH80. H/HyHyp?NK/9 /9 Hyp?NK/.Hy!Hyp?NK0. H/Hy'Hy"p?NK n gp`B@=@09̌n T@ @^op`B@=@0.gB@`pHй _(@/ Hy0Hy(p?NK0. HAZ8=P0.H/Hy=Hy1p?NK0.l$0. H/HyaHy>p?NK`@0. @x!L0. @x1n 0. @x1n By~0RG0@B@90RG=@0RG0@0. @ @0RG0@0.0. y̌=@0.gp_=@0.H_=@ Lp 0RG0@0.@ @0RG0@0.H_H@@ @0GB0RG6@ /0.Hї /NXO@ @` L0.@"@0.g0. Sn 0g0G"nRRG`n 0GB09̊S@ @bHH0@ PN`60RG6@ /0.Hї /NXO@ @` /0.Hї /NXO=@0RG0@0.@@?@ @0RG0@0.@?@ ` /0.Hї /N`XO=@0RG0@0.@HH@ @0RG0@0.H@?@ @0RG0@0.` /0.Hї /NXO=@0RG0@0.@@?@!@0RG0@0.@?@!@0RG0@B@90GB/ ?. ps?NPO09 |2<`XHXW PN`t0S@HЌ*@efB@0@ S`0S@HЌ*@eFS`0S@HЌ*@e0B@0@ B@ @S`0S@HЌ*@eS`09̄g?9̄HyJN \O30. @x1y ?9/ N \O0lp`R3Ryl09HѹI09HѹK>N/ 0. H/?.p?NEj 09L8N^NuNVH *n/ NXO>0@HG@?>0L N^NuNVH *n09gp`0<<~gB@FH@B@H@ހR` L N^NuNVH *n09gp`0<:|gHB@EH@B@H@. C A $$,R` L N^NuNV09H/HypHybp?NK09JxH/HyHyqp?NK09R@H@H@=@?.NTO=@0.l&0.H/HyHyp?NKp`.309H/HyHyp?NKB@N^NuNVHy?9JxN\ON^NuNV0.H//. Hyp?NK0.HAY=P0.H/HyHyp?NK?.NDTO?.NTO=@l"0.H/HyHyp?NK/. /. NXO??.pY?Nv 09JxH/HyHyp?NK0.H/HyHyp?NK0.yJxf> no ?.NTO no ?.NDTO09JxR@H@H@3JxB@N^NuNVHy?.N\ON^NuNVB/.Hyp?NK/.?9JxN\ON^NuNV0.m n?o&0.H/HyHyp?NK`0.H/HyHyp?NK0.HAZ8=Pl:?.NTO0l0.H/HyHy`0.HAZ8=P0. @x0(Rhybop`HyBg?.pN?Nv B@N^NuNV ylm09H/Hy/Hyp?NK09RH/Hy@Hy0p?NK09g09RH`09RH3R yRlp3R09RyTo 3TR09RH/HyUHyAp?NKByN^NuNV0.H/HyaHyVp?NK?9d?9Jx?.N\O=@p=@0.f0.HAZ8=P0.f0.l09̀gX nfN0.f~ y?llt9oXgl=y̌=ẙp3̌3̊HyoXHyoXNXO?BgpY?Nv Hyb?.p#?NPO3̊3̌`HyrBg?.pY?Nv RypHys09H/p%?p?NEj `0.H/HyHyp?NK0. @x0(RhyboHy/9cNPOp`n0. @x0(H/HyHyp?NKN0. @x h fV09̀g?.NhTORypHy09H/p%?p?NEj 0. @x0(`0. @x?( 0. @x/(N \ORypHy09H/p%?p?NEj 0. @x/(?.pS?NPO`j0.H/HyHy|p?NK0.H/HyHyp?NKB@N^NuNV/.N;XOHyM=?9Y&?9pE?Nv =@=ylp3lNjp?NTO3l y.l 09.yHy.p?NK09pf0` H09̀gHy?09Jx` Hy@09H/pT?p?NEj HyAp?pr?NPO yPf p?N TOpT` 30HѹJ|0Hѹo~BA9 ycB@Ag FlRRG`0RGFm"HyKp?pr?NPO?.N`Ryn80RG0@cB@@@<f0Z@< @#@n > ycB@: ycB 9c/0Hї /NXO20@ @Ag?.NTOHyU` yc0S@0@cBAAA0U@0@cB@@@_Ay̌3d|`N Fl60H/HyHydp?NK?.NTOHy`J0y̌U@3d|0RG0@cB@@@3j/.?9jpr?NPO09jm y?jo@09jH/HyHyp?NK?.NTOHy?9j`0RG0@cB@=@0.yg09̀gR nNfJ0.H/HyHyBgNK?.NTOHy?9jp#?NPOpe`J nIg nSfp=@09dy̌S@3d`> nNf. ycB@@@@=@09dy̌n`=y̌09̌H/HyHyp?NK0.H/HyHyp?NKF 9c/0Hї #Yl0. @|09dG<ho60H/Hy Hyp?NK?.NTOHy``znl0F0@cPRE`B6P ycB nf, ẙf"p=@BHy-Hyp?NK0.S@ @bH0@ PN09jH/HyHyp?NK09jHAY0: @g`Ryp09jH/Hy,Hyp?NKHy-?9jpr?NPO?NTO0. @|Rh09jHAY00. @|1yj0. @|1n 0. @|!yYl/.09jH/0.H?p?NEj 0.`09͚g:`0 9c/0Hї /NXO2B@.@@AgB 9c/0Hї /Hy.p?NKB@.@@H/HyHHyHyHyp?NO&09DH/HyHyp?NO&09Do09DH/p //9Z.NTPO/NPO-@p //.NPO/HyHyp?NO& 9n N # 9oV "gJ092fBHypd//.NTPO/NPO-@/.HyHyp?NO&BHyHyp?NO&N^NuNV 9JѹZ.BHyHyp?NO&/9JHy:Hy p?NO&/9oHyUHy;p?NO&/9IHypHyVp?NO&N^NuNV nPm nP lp`6 9xf"?<lN TO#xfHyN6~XOBn nl0. @xBRn` 9|f"?<lN TO#|fHyN6~XOBn nl0. @|BRn` 9f"0. @d?N TO# 9g2 9g/9N$XOB0.n @(=@?.N TO#f0.HH=@ nl`0.H/Hy+Hyp?NK0.H/0. Hї /p/0.H/NTPO/NPO-@Hnp/0.H/NPO/NLPO=@0.mP0.[@3#09H/Hy=Hy,p?NK0.n[@3 9/0.Hї #09H/HyOHy>p?NKB@N^NuNV0.H/HyXHyPp?NK0. H/HyhHyYp?NKp/HywHyip?NK nn nlp`0. n op`0. H=@-n Bn0.nlf0.Ю-@ n n1n nBh np 1@ np1@ nBh nBh nB n-HRn`0.N^NuNVByZ/9x/9?9?.Nr =@l&0.H/HyHyxp?NK`0.H/HyHyp?NKBn n@l,0.HAZ8p00.HAGBPRn`Bn nl0.HAYpBPRn`3ZByv0.N^NuNVByZ/9|/9?9?.Nr =@l$0.H/HyHyp?NK`z0.H/HyHyp?NKBn n@l0.HAYp0Rn`Bn nl0.HAY.BPRn`3ZByv0.N^NuNV0.H/HyHyp?NK nm nop`F?.NTO0m?.N|TO0m3d09HgN09HgN6B@N^NuNV0.m n?o(0.H/HyHyp?NKp`0.H/HyHyp?NK09ZH/HyHyp?NK09Zfp`N09Zlp`@Bn0.ydl&0.HAYp0f0.HAYpp0SyZ0. @x PB0. @x1n0.HAZ800.HAGBP0. @xBh 0. @xp 1@ 0. @xBh0. @xBh0. @x ^# 09.@ gRyv09vyto 3vt0.`Rn`ByZpN^NuNV09ZH/Hy Hyp?NK09dH/Hy0Hy!p?NK09vH/Hy@Hy1p?NK09tH/HyPHyAp?NK09Zfp`09Zlp`Bn0.ydl0.HAY.0f0.HAY.p00. @| PBSyZ09ZH/HyeHyQp?NK09.@gRyv09vyto 3vt0.`2Rn`T0.H/HyuHyfp?NKByZpN^NuNV0.H/HyHyvp?NK0.m& n?n0.HAZ8=P no0.ydn0.HAZ8p0RyZ0.HAYpBP09.@ gSyv0. @x PB0. @xp1@0. @xBh 0. @xp 1@ 0. @xBh0. @xBhp`20.HAZ80H/HyHyp?NKpN^NuNV0.H/HyHyp?NK0.m 0.ydm(0.H/HyHyp?NKp`*0. @|=h0.H/HyHyp?NK no n@l0.HAYp00.HAY.0gN0.HAY.BPRyZ09.@gSyv09ZH/HyHyp?NK0. @|p1@0. @|Bh 0. @|p 1@ 0. @|Bh0. @|BhpN^NuNV0.H/HyHyp?NK0.HAY=P0.H/HyHyp?NK no2?.NTO=@0.H/Hy Hyp?NKN^NuNV0.H/HyHy p?NK0. H/Hy&Hyp?NK0. H/Hy4Hy'p?NK0.m n?n0. m n? op`0.n fB@`0. n =@ n@l0.nl 0.n l0. n =@ no0.n l 0.nn\ n?on@0.nm0.n m&`0.ln@0.n m"0.nlp`0.n l0.nmpN^NuNV09HgHy5p?N\O=@0.mHyCp?N\O=@0.mBn0.ydl0. @x?(0. @x?(0. @x?(0. @x?( 0. @x?( 0. @x?(0. @x/0.HAYp??.HyzHyMNHyMp?N\O0m0. @x (gp0. @x/(NXO=@0.gB nHoHy`Hy0. @x/(HyHyMN`Hy`HyHyMNPOHyMp?N\O0m@Rn`n?9Jx?9ZHyHyMN HyMp?N\O0lByHB@N^NuNV09HgHyp?N\O0mHyp?N\O=@0.mBn0.ydlJ0. @|?(0. @|?(0. @|?(0. @|?( 0. @|?( 0. @|?(0. @|/0.HAY.??.Hy)HyMNHyMp?N\O0m0. @|/NXO=@ nHoHyR`HyV0. @|/HyGHyMNHyMp?N\O0m@Rn`?9Jx?9ZHyWHyMN HyMp?N\O0lByHB@N^NuNV/ HnN+XO0lp`N0mBn09g`0.Rn0@ p.0.Rn0@ 0.@ @Bn0.nl 0.Rn0@ 2nRn`09g0.Rn0@ p"09^g>0.Rn0@ p"0.Rn0@ pB0.Rn0@ p8`0.Rn0@ p#0.Rn0@ pA0.Rn0@ pM0.Rn0@ pJ0.Rn0@ p*0.Rn0@ p!0.Rn0@ pA0.f o09gh=no`0.Rn0@ p#0.Rn0@ 0.@ @Bn0.nl 0.Rn0@ 2nRn`09g y p!/.Hyl0.T@Hй /N 0.T@Hй /NXO=@0.R@0@ 0.@ @0.T@n y p1/.Hyp0.T@Hй /N 0.T@Hй /NXO=@0.R@0@ 0.@ @0.T@n09g~09gv y p(?9Hyt0.T@Hй /N 0.T@Hй /NXO=@0.R@0@ 0.@ @0.T@n09[pf 09Y(g09g0.Rn0@ p+0.Rn6@ HyhtNXO@!@09[pg0.Rn0@ pP`0.Rn0@ pMBn0nhtg"0.Rn0@ 2nhtRn` y B/9 NXO=@ y_Rlp\`09RU@y̌=@0.noXHywBg?9pA?Nv 0.H/HyHyxp?NK09RH/HyHyp`4/9 ?.?9pA?Nv 0.H//9 Hyp?NKB@&_N^NuNV-n nR Ng <*`R nH@ @ o<.!.H@@yb.HHA ` <+-@ .N^NuNV np//.Hy3p?NK n NfN/.N:XO#B/9Hyf(p?/. HyON/. 0o p3z nRp=@`Bn0.nl n(l N"nRQRn` NB(0.nl0.n n-H09gHnNXO n !@(`vBn0.nl" n l0n9J"nRRn`0.nl0.n n-H0n9JB09g n !|9J4 n 1n20.H/Hy9JHyp?NK99JHBHy9JHyp?NK09~f` 9f"pe?N TO#fHyN6~XOBn0.nl" ndl y"nRRn` yB0.nl0.n n-H09g n !y: n 1n8 y Pg`hBn0.nl" n l0n9T"nRRn`0n9TB0.nl0.n n-H09g n !|9TL n 1nJ`z 9f"?<N TO#fHyN6~XOBn0.nl" nl y"nRRn` yB0.nl0.n n-H09g n !yX n 1nV`Bn0.nl n(l N"nRQRn` NB(0.nl0.n n-HHnNXO n !@\ n 0(^H/HnHyp`R n-H`@09gv n \o, n /(\HyON)(PO0fNp=@ nRp1`: n o0 n /HyON)(PO0fp=@ nRp! n \o n #\F` n o n `p#F09Hg4/9FHyHnN BHnHyp?NK0.f-|9^ nB n !|9^hHy9^NXO n 1@f0.H/Hy9^Hy+p?NK0.N^NuNV np!@\ n n!|8 nBh n!|9 nBh n!|:4 nBh2 n!|;: nBh8 n!|<L nBhJ n!|=X nBhV n!|> nBh n!|? nBh n!|@ nBh n!|A$ nBh" np!@( n!|B. nBh, n!|C@ nBh> n!|DF nBhD n!|ER nBhP n!|Fh nBhfB@N^NuNV09HgB/.HyGp?NK n 0(H/HyrHyep?NK n 0(H/ n /(Hysp?NK n 0( H/ n /( Hy~p?NK n 0(H/ n /(Hyp?NK n 0(H/ n /(Hyp?NK n 0(H/ n /(Hyp?NK n 0("H/ n /($Hyp?NK n 0(*H/HyHyp?NK n 0(,H/ n /(.Hyp?NK n 0(2H/ n /(4Hyp?NK n 0(8H/ n /(:Hyp?NK n 0(>H/ n /(@Hyp?NK n 0(DH/ n /(FHyp?NK n 0(JH/ n /(LHyp?NK n 0(PH/ n /(RHyp?NK n 0(VH/ n /(XHyp?NK n 0(^H/HyHy p?NKB n /(hHyp?NKB@N^NuNV09zH//.Hyp?NK/. /.NPOBJ39rBy9t09H#9v39|39z39~3^9 y>fp`B@39B9By9Hy9r/. /.NƘ =@gB/.Hy+p?NO&09^g"09^H/Hy=Hy/p?NO&`@BHyJHy>p?NO& n 0(2H/ n /(4HyKp?NK FoPHyZ/9FBgp?NEj `2Hy[BBgp ?NEj B/.Hyrp?NO&0.N^NuNV n Xfp3v n Zfp3x09vH/HyHyp?NK09xH/HyHyp?NK09xf09vgp`B@N^NuNV09oVgp`B/.Hyp?NK09fH/HyHyp?NK09ffp`p=@0.H/HyHyp?NK09pg\09͔fTHn/.N PO/./.NPO0g*BHy/.p?NO&B/.Hy`-n/.?.N\O0gB/.Hyp?NK`Hn/.N pPOHn?.N\O=@0.H/HyHyp?NK0.gBHnHy`BHyHnp?NO&BHnHyp?NKB@N^NuNV09TgB/. Hyp?N`&B/.Hyp?NK09vf09xf09zgBHy;Hy+p`09pgj09͔fbHn/.N PO/./.NPO0g8BHy 9 f NF20mHy"NLXOBy` y 4f>09͠f6Hy1NLXONF20mp3̀By.#?͐`p3̀/9YlNGXO3̈̊ ẙfp`09̊3̌p3.NHDN*p`@/9YlN\XOByJx92g /9͌92H?N\OB92`90H @ fNN*ByJxp3̀90H`ByJx92g /9͌92H?N\OB92`90H @ fNByJx?9JxN(TO`N`/9YlN\XONYh/N4XONG`BHyIHy@p?NK09͜f6HyJNLXONF20mp3̀By.#W͐`"#JBgHy09͔f6HySNLXONF20mp3̀By.#a͐`099gHyb/9` yHh/9 NiPO39099f\HycNLXONF20m2p3̀By.#u͐`^09ͨf6HyvNLXONF20mp3̀By.#͐` yHh/9$NiPO0fHyNLXONF20mp3̀By.#͐`09͚fHyNLXONF20m`p3̀By.#͐`HyNLXONF20m*p3̀By.#͐`VBgHyPO0f N`/9HN4XO/9HN:XO/`09zgHy)N4XOp`09XgHyHNNXO`HyHNHyON°PO39099glp?Hy͐p 34N`VHy?NLXO09pg2NF20mp3̀By.#O͐`NNB3DNS09pgNF20mp3̀By.#P͐`09vf09zgHyQN4XO`09xgHyS`p?HyNF20mp3̀By.#h͐`$09XgHyHNNXO`HyHNHyON°PO39099gHyHNHyONPPO0l@HyiNLXO09pgNF20mfp3̀By.#{͐`N`HyHNHyONPPO39099V@ @bH0@`Hy|NLXO09pg*NF20mp3̀By.#͐`HyNLXO09pgNF20mp3̀By.#͐`HyBBgp ?NEj 09pgNF20mZp3̀By.#͐`099lHyNLXO09pgVNF20mp3̀By.#͐` yRf/9BBgp?NEj B/9Hyp?NO&09̬g`09XyV?NTO0l@HyNLXO09pgNF20mfp3̀By.#͐`p`V?9hNRTO0lDHyNLXO09pgTNF20mp3̀By.#$͐p 34NU0l&Njp?NRTOHy%NXlXOp `p`BJ/9YlNXO0lp3zNjHy&NX`?9hNRTO0lDHy(NLXO09pgNF20mNp3̀By.#:͐p 34NU0lfNjp?NRTOHy;``09vf 09xfp`B@3ByvNe0oT?9XNS0TO0fHy?NLXO09pgNF20mRp3̀By.#O͐`~NB3DNYp `009pgNNF20mp3̀By.#P͐`4/9YlNI*XOByB@9͈H@B@H@/HyjHyQp?NK3l9p3lNjp?NTONB3D39l09f098g09pfHykN6~XO09.y<09pgrNF20m.p3̀By.#z͐`ZHy{NLXO09.y<09pg(NF20mp3̀By.#͐`p?N&TOB@N^NuNV09ng, 9l$092fHyBBgp ?NEj `Hp=@?9:?90HnHycN 0l,09nH/HycHyp?NKHy` no3n09nH/HycHyp?NK09ng092f 9`p-@?9?9P/.NHPO0l Hy`09nfN 2B@9͈ @xfp3p098H/HyHyp?NK09lH/Hy%Hyp?NK09lf098fBHyLHy&p?NK09nf/9NNXXOHyMNXXO`DHyfNXOHycNXXOHyNXXO09xgp/NAx`Byp09nf09lf098f09fB@9͈ @vf&HyNXXOHyNXXOHy`B@9͈ @sf$HyNXXOHyNXXOHy`bB@9͈ @ggB@9͈ @rgB@9͈ @cf@Hy6NXXOHymNXXOB@9͈ @rfHyn`HyNXXOp?N&TON*Nʚ09pg,09lf$098fHyNXXOHyNXXO09nfN2HyBBgp?NEj BypN^NuNV0. ngp`B@N^NuNV?<N TO#Jfp`?<N TO#cg ycBph?N TO#9g?<N TO#Zg?<N TO#dg?<N TO#9g?<N TO#9gz?<N TO#9gd?<N TO#9gNB@N^NuNV?</./99N y9B(p3N^NuNV0. S@?/99/.N 0. S@0@BN^NuNV09f/9NXO-y9 .g:-y9=|HnHn/. nN 0l -y9`-y9/.Hy NPOHy3|NXON^NuNV?</99/9cN NB/9cHyp?NKN^NuNVByBy 9J#9#9#9p3Y,By9N^NuNV#J9 yJA9c y9BR9` y9BB@ y9 y9 yd yc yZ3NN^NuNV ymp`tRy09H/Hy*Hy"p?NK 9f"?<nN TO#fHy+N6~XO096 @0Y,096 @1yZ096 @1y9096 @1y9096 @!y9 096 @!y9096 @!y9/9JNXOR@?N TO-@ .g/9J/.NPO096 @!n .g/9cNXOR@?N TO-@ .g/9c/.NPO096 @!n .gH/99NXOR@?N TO-@ .g/99/.NPO096 @!n .g/9ZNXOR@?N TO-@ .g/9Z/.NPO096 @!n" .g/9dNXOR@?N TO-@ .g/9d/.NPO096 @!n& .gF/99NXOR@?N TO-@ .g/99/.NPO096 @!n* .g/99NXOR@?N TO-@ .g/99/.NPO096 @!n. .g?9N(TOB@N^NuNV09H/HyLHyEp?NK09lp` 096 @3Y,096 @3Z096 @39096 @39096 @# 9096 @#9096 @#9096 @ (g^?<096 @/(/9JN 096 @/(N$XO096 @B096 @ (g^?<096 @/(/9cN 096 @/(N$XO096 @B096 @ (g^pd?096 @/(/99N 096 @/(N$XO096 @B096 @ ("g^?<096 @/("/9ZN 096 @/("N$XO096 @B"096 @ (&g^?<096 @/(&/9dN 096 @/(&N$XO096 @B&096 @ (*g^?<096 @/(*/99N 096 @/(*N$XO096 @B*096 @ (.g^?<096 @/(./99N 096 @/(.N$XO096 @B.Sy09H/HyTHyMp?NK09N^NuNV ng n  f np R`N^NuNV n g?.HyUN\Op`BHn/. /.N^=@0.H/Hy}Hypp?NK0.l0.`:-yZ/.NXO0g-yd39Hy9Hn/9Z nN 0m/9dNXOHn?. /9Z/.Nj=@0.H//9ZHy p?NK nfp?NTO`" nf"/9ZHy NPOp3Y,p`p?0.H @?(NXO0gj0.R@=@0.n lV0.H"@0.H @0(if*p?0.H @?(NXO0f=n`Rn`0.H @ /09Hї -@/.Hy NPOHy3|NXO/.N,XOByY,ByB/9JHy p?NK` .g>-yd39Hy9Hn/9Z nN 0m/9dNXOHn?. /9Z/.Nj=@ nfHy NXO`p nfHy NXO`/.Hy NPO nop?0.H @?(NXO0fd0. S@no6?90.R@H @/0.H @/N 0g"0.H @/Hy *NPO`N Bn0.n lj?9/9Z0.H @/N 0f:p?0.H @?(NXO0f0.H @/N 2XORn`N yZf< nf nH?Hy /N\O` no/.Hy BNPO/9J/99Hy ]N Hy3|NXO`?.Hy bN\Op`x/9ZHy o`0.g8Bn0.nl* yZH0nHAf N,p`6Rn`0.f/9ZHy NPOp` yY,fp3Y,N^NuNV-n ng yZH nHAgR` ng nH`B@N^NuNV09Y,H/Hy Hy p?NKB/9ZHy p?NKByB@=@3 yY,gHy NXONz=@09n0.X@ @bH0@ PN`0.`0.o/9ZHy NPOp`j0.fp?NTO`0.g0.o/9ZHy `Hy NXO/9J/99Hy N Hy3|N`@B@N^NuNV y9BBy9By9N^NuNVRy9Bn0.yl, ng$099Ry90@9"nRRn` ng099S@0@9p+09H԰y9o*0.yl:099Ry90@9p Rn`099Ry90@9BN N^NuNV099Ry90@9B/99Hy NPON N^NuNV099f<3Y,Z09Y,H/Hy Hy p?NKp39ByY,B@N^NuNVBnBnBnBnB099gzB/99Hy p?NK y9R9  g/99NXOBy93ZY,09Y,H//9ZHy 8p?NK09Y,`#99/9J/9JHy Pp?NK/99/99Hy _p?NK/99/99Hy cp?NK yJA9cBnBn y9H=@fF09gp=@Nf=@p=@ nf09:H gp`D09n0.H/Hy sHy gBgNK0.f n\f 0.fp=@ n fp =@ n f0.gp `p=@ n;g n#f09fp=@-y90.f@ n f8 y9R90.0.g ?.NTO09fR9` n g n f0.g0.HH?NTO y99c$ y9 ( g y9 ( fS9` y9B y99c y9 (-f0.gS9 y9B`&0.f60.g0 n?f(?.NTO y9B/99NXOp` nf20.f y9B/99NXOp`dp?NTO` ng nfb y9Jc NS9 y9  f"By`p?NTON yZB y9B y99dL`> nfF y9S9JcN y9B`N yZB y9BByp` nf y9Jb$p?NTON yZB y9B`S9 y9Je y9  fN y9B` y9Je" y9  gN y9BS9`R9`P nfr y9B/99Hy tNPO-yJ nRPg..H0@.}H@g.H`p^?NTO`Hy3|NXO` n l0.f0.fR9`0.gBg0.H?NXO`vp=@Bn n o* n?g" ng0.g y9R9p\Bn0.g?.0.H?NXO0.H//9JHy xBgNK0.fp30.f n g y9R90.`p?NTO?<Hy N\Op3Y,p`f#99/99NXOByY,ByB@`> y9B0.g Bn nB#99/99NXOByp3Y,N^NuNVBn ng. yJA9c y9R9"nRRn` y9R9p  y9B#990.N^NuNVBy-yZ nf-y9/./.NPO-n nB n  fR` n  g6 n  g, ng$ n  g nR"nRRy` nB09N^NuNV ng "nH0@.}fB@`R`pN^NuNVBgN2TO0g BgNTO`Hy3b y3pNXO=@0.N^NuNV?.NTO n f p ?NTON^NuNV09gHy NXOHy3|NXON^NuNV09gP0. g>p?NTOp ?NTOp?NTO0n.}H@fp^?`?.NTON^NuNVp9@ n-P .g nRH=@ n\f nH=@ n{fR nH=@p=@`Bn0. |2<`XHXW PN n nBnBn ngV n 0mL.H nHAn: nl20. @l$ nH0.A@0=@RRn`0.g no n ` nff nRH?N4TO=@l .S n ` nRH?N4TO=@l .U`2.A0.H@A`p=@0.g n }f noR n 0.`2Rp =@p9@`p=@p7@R`p=@`pN^NuNV n0m n9n 0.@0`6 nAm nFn 0.@7` nam nfn 0.@W`pN^NuNVBnBnB/.Hy p?NK nRPgR.H |62<`XHXW PN`0.f`0.fp=@`B@` .0m .9np=@`0.N^NuNVBn ng8"nH0@.}g nH?NTO nRRn`0.N^NuNV/. NXO=@g nlp`Bn0.S@no/. 0.H @/NPO0gZ?./. 0.H @/N 0fp`B@=@gD?./. 0.R@H @/N 0g n00.H @0(`P0.gp`FRn`L?./. 0.S@H @/N 0f0.S@ n00.S@`pN^NuNVHyNXO/9GNXOHy NXON^NuNV0.H/Hy`Hy`p?NK0.l0.`0. @_bH0@T PN`HyNXO`Hy,`Hy`Hy`N `Hyal`/9P`Hya`Hyb&`HyT`Hyb`/9N XO y*fHyc`09*HAV/?9*09* @@@?HyclN `$Hyc`bHyc`XHyD`,Hyd`DHyd`:Hye3`0Hye`&Hy`Hyf`HygV`Hyh`Hyh`Hyh`HyiU`Hy`/9`Hyi`Hyj`Hyj`N =@l0.`T/9@HyjNPOHy `ZHyk`rHyT`FHy`HyT`4Hy`*Hy` Hy8`Hy` /9JHyLNPOB@N^NuNV nfHyHyN=@m* ng ng Hy@`N =@m nf p3`~ nft3`hN҈``HyvVHy\Hy[?9HyN=@mN =@m0. @bH0@ PNHyvVHnp ?HyHygN=@0.lBn?<?.?.Hy,`HyvVHyHyp?HyN=@mN =@m d3(`xHy(`p?Hy/9ftN HyvVHnp ?/9ftHyN=@?.?.Hy*NPO3`ZHy``09HйoP`0.`HyvVHy Hy p?HyN=@m(0. @brH0@ `fHy<`09Hйc`fBy<`vp3<`jN` D?. ?.N`4092g Hy `\#I^oHycHy:/9oN HyvVHyf/9I^?9HyN=@l nf HygN` N =@m009nf Hyx`p /0.H/NTPO-@ FfpK-@?.N TO0l*/.HyNPO`HyvVHyHy?9HyN=@m nfHyvVHyHy?9HyN=@mdN =@m nfp`B@3̼ nfp`B@3̾`N8` HyvVHnp ?HyHyN=@p??.?.HnNP =@0.m nlp=@0. g:#ftG?.Hy/9GN Hy/9GHy`3f yfop`B@3̰ yfo?9?9f?9\Nn\O=@0.y\g3\09g?9f?9\HyNPO`HyvVHypHyWp?HyN=@m0.J@gd`HyvVHyHyp?HyN=@mF?<N TO-@ .fHyNXOp`Bn nl&0.H @0.HCٰ0Rn`0.J@g0 @g(`xHyvVHyHyp?HyN=@m0. @bH0@> PNN =@m>/9JHyv`#ftGBgHy/9GN HyvVHnp ?/9GHyN=@mp0.l Hy`nN =@mR?.Hy/9GN 0. gxHy/9GHy`XHyx`HyvVHy&Hy%?9nHyFN=@mN =@mB3g p3̐`LBy̐`BBHnHyDHy+N=@m n {f4/.NXO=@0.S@0@ }f0.S@0@BR/.NXO`HyvVHnp ?HyiHyNN=@0.lBn?<?.?.HybNP =@mZ09byfn Hyl`?9bHy/9ftN 0. gRHy/9ftHy`HyvVHyHyp?HyN=@mj0.J@g @g@`?. N`HyvVHyHy?9HyN=@mN =@mx3P yPfp333309PH/HyHyp?NK`DHyvVHyHy?92HyN=@m nfNHyvVHnp ?HyHyN=@m nm no ng Hy`N =@m nWoB@`p3$3&`HyvVHy$Hy#p?HyN=@m0.J@gN @gP`#09g:09f0 "fHycHy`|/9HycHyN `HyvVHnp ?HyHywN=@?p?Hy/9ZN 0g p?Hy /9ZN 0f|N =@mp=@ n l0.HAٰ0Rn`p=@ nl0.HAٰ0Rn`3ۮ yPfF0.f>09gHy NXOHyBNXOp3333`pn=@ no nm" no nm0.nm no(?.HyN\O .g/.N$`0.@=@0.f80.g yPf( ng nf09gHyNXO`0.H @0`Bn nl&0.HAٰ0.H"@0Rn` .g/.N$`HyQ`Hy̞`:Hy`HyvVHnp ?HyPHyDN=@mN =@mx n o n?m n_o nl nfp.@3`^p.@`J3z`>Hy{`. .g /.N$XO0.N^NuNVB@9?HyN\OBn nl0.@HAٰ?0.@?0.HAٰ??.HyN nf?9ڮHyN\O`HyNXO0.@HAٰ?0.@?0.@HAٰ?0.@?HyN nf?9ۮHy N\OHyNXORn`HyNXON^NuNV=yj~-yIbHyHy[NPOSnoX"n Q -f"n Qh .Yf p3` .yfg09(g0.yHH?NTO`N =@Bn0.nlp?NTO=@ no09gn0.yHH?NTORn`N ` n f0.f.09@g&0.Rn6@I^09@HH?N~,TO0.g"0.S@0@I^Hp ?N~,TOCg0.Rn6@I^p ?N~,TO09Bg0.Rn6@I^p ` ng0.@09Fgh09g`0.@gV0.Rn6@I^p?N~,TO0.Rn6@I^0.HH?N~,TO0.Rn6@I^p`0.Rn6@I^0.HH?N~,TO nxl n g nf6-yI^ yI^B0.H//.Hyp?NK?./.N \O0l Hy`Bn09(gB09>g:09f yf(-n ng nR`/.NXXO09Hg?9HNTO0. g^ n fVBn0.n gbp?NTO=@mN09>g09(f09gn0.HH?NTO`09>gp09(ffN 0oBgNTO=@m09gn0.HH?NTO`9g2-| ng" nRH?N~,TO?N TO`/.p$?N\Op?NTO0.`.?9?9P/.NHPO0l$HyNXOB@LN^NuNV0. @bH0@† PN0.l0.`\/./9I^NPO-yI^HyvVHyHyp?Hy.N=@m=nN =@m0. @bH0@– PN`HyvVHnHy HyNR=@`VHyvVHnHy+Hy`HyvVHnHyOHy6`HyvVHnHyxHy[`?.HyN\Op`^?./.NF\O3H`F?./.ND~\O3L`.?./.NF(\O3N`?./.NE$\O3PN^NuNVp?NTO nfB@`0. g@By9By9B9By9By9By9p39B9By9Hy9`BB/.p?N=@0.o/.HydNPO`B9d0.N^NuNVp?NTO nfB@`0. g@By9By9B9By9By9By9p39B9By9Hy9`BB/.p?N=@0.or/.HyZNPOB/9@Hyp?NO&BHy/9p?NO&HnNXOBHy/.p?NO&`B9Z0.N^NuNVp?NTO nfB@`0. g@By9By9B9By9By9By9p39B9By:Hy9`BB/.p?N=@0.o/.Hy[vNPO`B9[v0.N^NuNVp?NTO0. g@By:By:B:By: By:By:p3:B:By:Hy:`BB/.p?N3H09Hor/.HyI$NPOB/9@Hyp?NKBHy/9p?NKHnNXOBHy/.p?NK`B9I$09HN^NuNVHyN:XO092gHycHy`NHycHyNPON -@lHy NXO`& "fHy`/.HyNPOHy NXO09ngHy)`Hy/NXO092g y4fHy6NXO y4fHy?NXO y4f2 y-fHyH` y-fHyU`HydNXO y4fHymNXO y-fHyzNXO09ngB09gp`p=@ nf yffp`p=@?.HyN\O`HyNXO09HH?N/XTO/HyNPOHyNXO09(gHy`HyNXOHyNXO y PfHyNXO`l yPfHy`09PfHy` yPfHy` yPfHy` yPfHy`?9PHyN\OHyNXO09$g?9&Hy N\O`HyNXO09ng092f098f -|`0 y8f -|` y8f -|`-|"/.Hy*NPO y8f,09:g?9:Hy7N\O`HyINXO09* @@@??9*HyYNPON^NuNVHywNXON^NuNVHyNXOHyNXO09̪gHy`HyNXOHyNXO09\gHy`HyHyNPOHyNXO09HgHyI$HyNPO`HyNXOHy$NXO09^J@g @g-|<`-|0`-|5/.Hy>NPOHyDNXO09LgHyd`HyYNXOHy^NXOBn0.ygRn`0.yHyHy`(HyHy`HyHy` HyHyNPOHyNXO09PgHyZ`HyNXOHyNXO yhfp`p?HyN\OHyNXO09|gHy`HyNXOHy[Hy#NPOHy3NXON^NuNVHy5NXO09̂g?9~?9̀?9|Hy]`?9~?9̀?9|Hy{N ?9zHyN\O?9̆?9̄HyNPO ÿfHyNXO`?9̈HyN\OB@9?B@9?HyNPO?9,HyN\OB@9?B@9?Hy8NPO?9bHyON\OB@9?B@9?HyiNPO09̐g?9̎HyN\O?9THyN\O?9\HyN\O09̜g?9̚HyN\O?9^?9`HyNPO?9t?9fHyNPO?9?9HyNPOHy*NXO y̾fHyE`^09̼gHyP`HyXHyMNPO09̼g,Hyo09̾gHyg`HyiHyaN HytNXON^NuNV/9/9@HyvN NGNN@NKlN^NuNVHy~NXO/9ZHyNPO/9JHyNPO/9Z.HyNPO/9J|HyNPO/9K>HyNPO?9lHy%N\O?9nHyCN\O?9rHyaN\O?9jHyN\O?9pHyN\O 9ZoN09HH?N/XTO/HyNPO09 gHyNXOHyNXO09̐g?9̎HyN\O`HyNXO09̾gHy:`Hy>HyNPO?9f?9tHyANPO?9\?9THyeNPOHyNXO09̜g"/9[f09̚H?HyN `HyNXO ẙfHyNXO`?9̊HyN\O?9DHy N\O 9n N # 9o0 "fHy/NXO`/9HyVNPO09Do09DH//9Z.NPO-@/.HyyNPO coh "g\092fTp /pd//9NPO/pd//.NTPO/NPOZ/NPO=@?.HyN\OpN^NuNVN0N|=@09*HH?NTO0.N^NuNVBnB09ng2?9P/9Nz\O=@0.lHyNXOB@` . f-| /. NXO=@ nlp`B@=@0.H//. Hyp?NK0.np=@BnBn09H @Z40f0.T@?N TO-@ .fHyN`f-n n gB"n n"nH0@.}g nH?NTO nRR ` nB-n #JfN*BnBy09ngzp?NTO=@0.H/Hy Hyp?NKN=@gn0.H/Hy-Hy p?NK0.Sn0gTBgNTO`p?NTO=@0.H/HyFHy.p?NK nop.@yf@NB=@.f0.gp=@p3` yJRJRy Je#J yJB(09gB@.?NTO09NgB@.?p?NXO0lByN0.g p=@`B09H @Z40f.B@.H@B@H@ @.}gB@.?NTO@p./HyTHyGBgNK0n HH/HybHyUBgNKBA.0n HAg`=n0.Sn0oNBA.0n HAf0.n=@0.n?0.nHЮ //. N 0fRn0n gNB=@nn09oL0.nyo:09H @Z40f .g /.N$XO0.N^NuNVB/. NXO=@0.H//. Hycp?NKBnBn09H @Z40f0.T@?N TO-@ .fHymN`-n n gB"n n"nH0@.}g nH?NTO nRR ` nB-n -yJ nRP e-|09H @Z40f.B@.H@B@H@ @.}gB@.?NTO@p./HyHy~BgNK0n HH/HyHyBgNK0n HB@.Ag`=n0.Sn0oN0n HB@.Af0.n=@0.n?0.nHЮ //. N 0fRn0n fp=@` nJf09H @Z40f .g /.N$XO0.N^NuNV n #: .g 9:fp`T/.NXO=@f y:BB@`6Sn y:R:2n0nBHy:/.N[ PON^NuNV/ .f-|0.H//.Hyp?NKB n /Hyp?NKHn?9,/.HytNj=@0.l <`09Hg@Bn0.̰nl20.H/0.H @ /Hyp?NKRn` nf n g n `@ <`6 nf| n -Pg nf <` n \fR nH@ @%fR nP-|.f .` .0m4 .9n,.009m8.HH09(ЁA[`*.H0@.}g. .HHAf|-P .f <`P .&fHnHn/.Nf 0l <`"?.?.N|XO0oJna0.HAX0nm,0.HAj-P .g0.H @` .f <`Bn0.nl=|0.H&@?.N TO-@'@0.H @ (fjBn0.nl00.H @ (g0.H @/(N$XORn`0.H/HyHyp?NK <`0.H @ g0.H @ ` <-@ n f0.g` n  g n  fR`/.NXOS@=@0.o.0n  g0n  f0.Sn0@B`HnHn/.NvV 0lj0.H/HyHyp?NKBn0.nn00.H @ (g0.H @/(N$XORn` <`0.H/0.H @/(Hyp?NKRn`09HglBn0.̰nl^0.H/0.H @ /Hy p?NK0.H/0.H @/(Hyp?NKRn`0. @b&H0@ PN`?9|/./9IZNP =@ no0. @IZ (` <4-@Bn0.nl00.H @ (g0.H @/(N$XORn` .f <5`/.NÎXO-@Bn0.nl00.H @ (g0.H @/(N$XORn` .f\ <6`$ .-@/NXO=@-|70.g` n  f RSn`-nBn0.nl n  g RRn` n  f nRB n  fR`-|8 .g$ ng?9|/./9IZNP `p=@-|90.m/.?.N\O=@oN @oT=yJp?NJTO=@N&3J0.ff09R@HAF-P .fH-|:`>BHyQHy;p?NKHyRNXON& @n-|pBn0.nl00.H @ (g0.H @/(N$XORn` .f <q` P-|kf nB0.oh/.N'XO=@?.HyrHykfN Bn0.nl.0.H @ (g0.H @/(N$XORn`-|kf nB/.N(XOBn0.nl00.H @ (g0.H @/(N$XORn` .f <u` f noP/.NXO=@ .-@/NXO=@0.l <v` &0.l <w` 0.n=@Bn no,/.NXO0g/.NtXOS@=@0.lBn0.m 0.̰no -|x`09H @Z40f/.NXO/.NXO0.HЮ-@-|zBn0.n̰nmZ?. .R//.N 0f,0.nR@?Hy|HykfN -|kf`Rn`-|Bn0.nl$0.H @ (g0.H @/(N$XORn`-|kf nl/./.NPO` /.NXO=@/.NXO=@ nlB@` /.NXO=@0.nR@=@ nm0.g0.g-n0.Sn0g09H @Z40g?././.N`?././.N 0f80.g"?././.N n-H n-H`x nR"nR`b nBBn0.nl00.H @ (g0.H @/(N$XORn` <kf-@`L/.NXO0gN/.NtXO=@0.m. nl&-|kf nR0. nB-|kf`-|`-|‚Bn0.nl0.H @ (g0.H @/(N$XORn`-|ƒ/.NXO0o2-|kf nH=@0.@?Hy„/.N Bn0.nlz0.H @ (g0.H @/(N$XORn`-|kf/.NXO?Hy‡/.N Bn0.nl0.H @ (g0.H @/(N$XORn`-n-|kf ngD"nH0@.}g nH?NTO n` "n nRR` nBBn0.nl00.H @ (g0.H @/(N$XORn`-|kf`6/.NXO0g/.NXO0g/.NtXO=@/.NtXO=@0.Y@ @b>H0@¶ PN`.0.nl$=n`0.no`0.HH@=@-|kf?.HyŠ/.N `-|Bn0.nln0.H @ (g0.H @/(N$XORn` no /.NXO0g/.N4XO0g0 nf4 no,/.NXO0g/.N4XO0f -|Ž`-|kf/.NXO=@ nf4 no/.NtXO`0<=@ noB/.NtXO`6 no/.NtXO`0.=@0.̐nR@=@ nlp=@0.oB0.nn80.HЮS-@Bn0.nl nR"nRgRn` nB-|kfBn0.nl0.H @ (g0.H @/(N$XORn`-n-|kf ngD"nH0@.}g nH?NTO n` "n nRR` nBBn0.nl0.H @ (g0.H @/(N$XORn`-|/.NXO0g/.NtXO=@0.o-|kf nB/.NXO=@0.o`Bn0.nlL-nBn0.nl2 .kf @m -|` nR"nRRn`Rn` nBBn0.nl0.H @ (g0.H @/(N$XORn`-|kfHn/.N[ POBn0.nl0.H @ (g0.H @/(N$XORn`B9kf nf"-|kf?</./.N `$/.NXO0g/.NtXO=@0.m-|kf/.NXO=@ nlp ` nH@ no=| no=|0.no=n nfD?././.N n-H=n0.nl\ nRRn`0.nBn0.nl nRRn`?././.N n-H nBBn0.nl&0.H @ (g0.H @/(N$XORn` <‘&_N^NuNVHp=@-|J2HnHn/.NvV 0l"p=@0. @"b>H0@" PN`T-|J2Hn?9r/.HyjNj=@lB`"09HAf?Hy’HyJ2N `?9I"Hy•`09H @Jt?Hy˜`HnNXO .g ng nJ2 n J3p J4 nJ5 nJ6 nJ7p J8p=@ nl0nJ%2nRn`B9J=`,HnNXO .g ngp=@ nl0nJ2nRn` n ( fp0` n(HJ8 n J9Bn n l2p?0.HA/ nHhN 0gRn` n fp?J7J6`.Rn n lp0`p1J60.H H@@0J7B9J:`,N$`( <h`9Hg <H` Hy£`BnBn nAlR y  f 0.fRn`0.Rn4@J2"y  fp_` yH`0nJ2B`HnNXO .gT ngJp =@ nl&0nJ'2nRn`HnNXO .g ng nHhNXO(p yd>o Hy NXOBy> nBp` .g .g/.NXO=@0.H//.Hy.p?NK0.m nH=@gV n\g nR"nR0.Sn0l` n(H=@0. |î2< `XHXW PN`T nRPB .0m2 .9n*09m<.HA0H09(ЁA[`*.H0@.}g. .HHAf|-P .gHnHn/.NvV `0HnHn/.Nf 0mBn ng$ n [fRn n ]fSngR` n ]fR?.?.N|XO0on`0.HAX0nmn0.HAj-P .gR0.H @ g>HnHn0.H @/`A-HBnT0.Rn @l& n (fR`"n ng RR` nB nm& ng n (gR` n )fR0.T@?N TO-@-@/.HyCHy7p?NK .gBn0.RnH @!nBnp=@"n ngt n (fRn n )fSnf nBRp=@`D n ,f0 nf( nB0.RnH @ .R!@ ng RR`BHnHyDp?NK0.f6/.HysHy[p?NK .g:/.N$XO`*09Hg@Bn0.nl20.H/0.H @/(Hytp?NKRn`?.HnHnN[ -@ .g, nR"nRg0.Sn0l`SRn .g/.HyÞHyÊp?NK/.N$XOB` .T-@ n (fRA-HBn0.Rn @l& n )fR`"n ng RR` nB nm& ng n )gR` n )fR-nHnNXOR@?N TO-@ .g@A-H/./.NPOp=@HnHn/.NvV /.N$XOBHnHyßp?NK n$f HnN.`^ nmg nMfD?9|Hn/9IZNP =@ no0. @IZ (` <î` HnNoXO-@ .g nR"nRg0.Sn0l`SRn`HnNTXO=@0.l nR0.TUn0.` nR0.` nBSy> n n0B@N^NuNV?< N TO#IZfp` yIZB yIZB yIZBhB@N^NuNV/ ?<N TO#c|fHyDŽN6~XO?<N TO#cfHyǡN6~XOBn nl( yc|0.0.H @cBRn`N0lHyN6~XO?<HN TO#cxfHyN6~XO?<N TO#ZfHyN6~XO?<N TO#JtfHyN6~XO?<N TO#fxfHy5N6~XO?<N TO#[rfHyRN6~XO?<N TO#Z4fHyoN6~XO?<N TO#cfHyȌN6~XO?<N TO#oPfHyȩN6~XO?< N TO#I^fHyN6~XO?< N TO#ftfHyN6~XON}j0lHyN6~XO yZBP yfxBP yJtBP y[rBP yZ4BP ycBP yoPBPBy09H @cxBP09H @cxBhp36Bn nl0.HAjBRn`HyNXON@/9òHy&NPO/9öHy3NPOHyúHy9NPOHyHy?NPOHyHyDNPO?9I"HyKHnN HnHnHnNf =@ no`?.0.H?NXOBn0.yI"l0.n809HAF.RB/.Hyɋp?NKBnBn` RnR09HAF.R` nf&BHyɟHyɔp?NKNFp`P nRp  nB09g09g/.HyɠNPOB/.Hyɤp?NKB@N^NuNV-n0. H/HyHyɺp?NK0. R@?N TO-@f"BHyHyp?NKp`096HAj/?. /.N f/.N$XO nBp`f0909H @oP0g(HyNXONF0.g09ذnm nfp`B@3ð09H @cx PfJ y6o@096HAj P(H@g NF?9FN(TO09f`009H @cx PfBHyˮHyˡp?NK09H @cx309H/Hy˽Hy˯p?NK-yJ nB ycg/9c/.NPO ycBB/9JHy˾p?NK`09H @cx Pfx ycg/9c/9JNPO ycB`t?</9JN<\O=@l\ nl nfHy`Hy HyNPONF`09gHyvVN$XO?9FN(TOp3f ByR09f gtBHyMHy4p?NKNHyvVHyTHyVHyN?9RHyN=@0.H/HyhHyWp?NK nf~HyTN XO=@0.H/HyHyip?NKN,0. |2<`XHXW PN`&p`p*`p.`/9JHỳNPOp=@09H @Z0g09H @ZRP09H @Z Po$ n/.NXOn`0.HAj-Pfp`0.o@0.R@?N TO-@f/.HyNPOp`/. /.NPO`B0.H @ `*B/.Hy1p?NK/.NXO?9|/./9IZNN @o /.NXO09|H//.HyBp?NKBn nl<0. @IZ g(0. @IZ//.NPO0oRn` nf&0.H/HyjHyTp?NK`0.H//.Hykp?NK0. @IZ g=y|0.no|0. @IZ0.S@ "@IZ 0. @IZ0.S@ "@IZ!i0. @IZ0.S@ "@IZ1iSn`|0.R@?N TO-@ .f/.Hy{NPO`/./.NPO0. @IZ 0.on0.R@?N TO-@ .fB/.HyϗNPO0. @IZ/N$XO0. @IZB`/. /.NPO`B0. @IZ!n0. @IZBhRy|0.N^NuNV .gB/.Hyϳp?NK n \fR n %f nhg\B yoX .0mP .9nH.HA0H09(ЁA[-P.HA0H09(ЁA[`: .!m .~n.HHAf|-P.HHAf|B .g*B/.HyϾp?NK/.N$XO`BHyHyp?NK`h n &fHnHn/.Nf 0lp`>n`0.HAj-Pfp`0.HAX0.Pop`0.H @ gPB0.H @/Hyp?NK0.H @/N$XO0.H @B`BHyHyp?NK?9|/./9IZNP =@l(0.H//.Hyp?NK0.`80. @IZ g0. @IZ/N$XO0. @IZ (g0. @IZ/(N$XO=n0.y|l|0. @IZ0.R@ "@IZ 0. @IZ0.R@ "@IZ!i0. @IZ0.R@ "@IZ1iRn`zSy|09| @IZB09| @IZB09| @IZBhB@N^NuNVBy|Bn nl@0. @IZB0. @IZB0. @IZBhRn`Bn n2lF0.HAFBBn n l"2.H0.(ЁA[BRn`Rn`Bn n~l0.HAf|BRn`Bn nl*0.HAjB0.HAXBPRn`N^NuNV ylByp36p3`09H @cx Pf y6or096HAj g0096HAj/N$XO096HAjB096Sy6HAj/N:XOSy`.p36`"09H @cx Pf yo.09H/09HAIj/Hyp?NK09HAF. $ yJB09R@HAF g409R@HAF/N$XO09R@HAFBSySy09H/09HAIj g09HAIj/`Hy4Hy%p?NK yl.HygHy`HyHyNPO09FgHy`Hy!HyNPO?9HHy%`NHHyGNXON/`/9 N:h`r y*fHyu`09*HAV/?9*09* @@@?HyI`Hyy`N`N;`HyNXOpN^NuNV09ngHycHyNPO`HyNXOHy(NXON^NuNV0n.}f nam nfo nAm nFnp`B@N^NuNVBn .g/.Hy3NPORy /.NXOX@=@ . f-|: n R H=@g n(fRn n)fSn0.lBn n,f40.f.Hy3|p,? y3N\OHy3|p-? y3N\Op =@Hy3|?. y3N\O n f(Hy3|p ? y3N\O n  fR `p`8Rn0. @Oo4Hy3|p-? y3N\OHy3|p ? y3N\Op=@Ry nl y oN:0fp`Hp=@By `Hy3|p ? y3N\ORy 09 @oN:0gBy B@N^NuNV09̪gHy\`Hy_HyLNPO09̪g"09gHys`HyvHycNPO09gHyڅ`HyڈHyzNPO09gHyڞ`HyڡHyڌNPO09gHy`HyHyڥNPO09gHy`HyHyNPO09gHy`HyHyNPO09gHy`HyHyNPO09gHy(`Hy+HyNPOB@N^NuNV ng nHn gR` nHn f .`BN^NuNV/ "y:"H0@.}gR:"` y:"H |2<`XHXW PN y:"H?NTO0gxp =@A-H y:"H?NTO0gJ&nR y:"H2@.}g y:"H?NTO` y:"HR:"` nB"y:"H0@.}g. y:"H?NTO |R2<`XHXW PN` y:"H`p`p`p=@R:"A-HB:& ngP nH@0=@ n on'0.nm,p3: 09f nH?Hy/N\OpN`|Hy:&0.H/NLPO/0.Hї #:&R`v09f y:"H?HyMN\Op3: R:"N ` y:"R:"H`pE&_N^NuNVp-@p=@ . lB` .l .D-@ . gp=@ . gF . gHn/.NLPO-@ . -@ . gHn/.NLPO-@`Hn0.H/NLPON^NuNVNĨ9:*H @^f2-y:,N :*N/9:,/.N4PO#:,N^NuNV9:*H @*g,9:*H @/g9:*H @%g9:*H @&f9:*H@N :*-y:,N.H@% @ bH0@v PN`Hy:,/.NLPO#:,`f 9:,fp`Hy:,/.N`Hy:,/.N` .:,`N^NuNVp-@ oHn .S/NLPO` .N^NuNVNN$N^NuNVBn .l .D-@ . l . D-@ .g . f . Ю`". . fRn .-@ . -@ ` gl  gb .g\ . gV .f .-@` . f . -@ ` . l-n-n -n . ` .g . f . Ю`p4.N^NuNV9:*H?HynN\O g9:*H@N :*-y:,N8.H |Ţ2<`XHXW PN` .й:,#:,` .:,` .:,` .$9:,`/9:,/.NLPO`29:. .4`29:. .4`N^NuNVN8NVN^NuNVN :*N.9:*H @Eg09fHyvNXOp3: 9:,N^NuNVBy: #:"NB-@-|e/.Hyۙ/.N 09: g <۝` .N^NuNV9:*H @Nf #:&:,`\9:*H @(f0N :*N.9:*H @)g.09fHy۞`09fHy۹NXOp3: N :*N^NuNVN9:*H @!f N :*/9:,NXO#:,N^NuNV9:*H @-g9:*H @~f@9:*H=@N :*Nl n-f 9:,D` 9:,F#:,`NlN^NuNV n?o n`ln  n`m nzop`"n`0.HAj-Pg0.HAX=PBn0.nn00.H @ g0.H @/N$XORn`0.HAj/N$XO0.HAjB0.HAXBP0. gj0. R@H?N TO-@ .g*0.HAj 0.HAX0 Bn0.n n0.H @BRn`B@N^NuNV nBP n BPBn/.NXOno0n ]gRn` no/.HyNPOp`p?/.HnN A-H .\f .&fR n &g HnHy` nh .?o .[l.H@ n@@ .`m .zn n ([gHnHy`R.H n 0 .V-@A-Hp=@Bn nl> ng6 n [fRn n ]fSng nR"nRRn` n ]gHnHy'` nBA-HA-Hp=@HnHn/.NvV HnNXO0fHnHyT`|HnNtXO=@l$09Y,fHy܈NXOHnHy܊`F n0B@N^NuNV n@fp`=@0.@`=@0.m nop`B0.HAj fp`*0.HAX0. Pn0.HAX0N^NuNV n@fp`=@0.@`=@0.m noB`>0.HAj-Pg0.HAX0. Pn0. H @ N^NuNV-n n \fR n %g" n &g/.HyNPOp`/.NXO @l /.Hy` n %f n(gHyNXO` n &f n ([g /.Hy;` n %f8 n(H=@0n.}gn n 0 np0p`f n &fZHnHn/.Nf 0l/.Hy[`?.?.N|XO0l Hyz`D n 0 n0p`pN^NuNVA-Hp=@HnHn/.NvV 0lp`,A-H/.NXO0g/.NtXO n 0B@N^NuNVHn/.NʸPO0lp`J0.g 0. n`0. n?.HyݩHnN Hn/.NPO n0B@N^NuNV .fp`B@=@0.H/HyݹHyݬp?NK-nBnBnBnBn .g nfX0.g0.n g|Rn0.g$0.@0[k/.Hy[jNPO`N0.H @ `80.f n  g n  fR`z n {f(0.f0.f .R-@p=@p=@Rn`V n }f&Sn0.f0.g np Bn`.0.l(` n  g n  g0.f-np=@ nlh0.g` n  g n  fJ nBBnBn0.n gLRn0.g"0.@0[k/.Hy[jNPO`0.H @ .R-@`0.fF no>Rn0.g"0.@0[k/.Hy[jNPO`0.H @ 0.g09HAf0.R@0N^NuNV09H/HyHyݺp?NKRy09 @2o>09H/HyHyp?NKSyHyNXOB@`09HAF.0. "@IZ 09HAIj0. "@IZ 09H/09HAF./Hyp?NKRy yRo409H/HyHyp?NKSyHy`209H @ZBP09H @fxBP09H @Jt09S@H"@Jt009H @[r09S@H"@[r009H @Z409S@H"@Z4009H @c09S@H"@c009H @oP09S@H"@oP009H @cxp009H @cx1y09HAFBB0. @IZ/HyEp?NK0. @IZ/HyNNPOp%[jB9[lp=@ n l"0.@0[kHy[jNXORn`Bp ?/. N˂ pN^NuNVBnBn n-P n -P n  fR` n {f2Bnp=@ nR"nR n  fR`-y nR"nRfS ng-y n {fRn n (fRn n )fSn n }f&Snf nRp) nR"nR`p n ,fP0.fJ nRp) nRp, nR"nRfSR nR  gS`< nR"nR`& nB` nR"nRfS n n 0.gp`B@N^NuNVBHn/9HyXN=@l0.` nfHyބNXOp`f/./9I^NPO-yI^N =@m/.N"XO0fBy߆/.NzXO`p3߆/9 N:hXO09߆N^NuNVNNKx9NgHyNNXOB9NByN^NuNV .fBy`R/.NXO=@0.y yOo/.HyޮNPO3`/.Hy޲NPON^NuNV .f-| . f-| 0.Sn0g nRP.H0@.}g.H?NTO@ n R P.H0@.}g.H?NTO@.H.HAlp`.H.HAofp`B@N^NuNV nVgBHy:4Hy'HyN^3:2l y:2fVHy(NXOp`/9:4/9I^NPO#I^oHy߈Hy:0/9:4Nd 3:2l 09:2` nEfN 3:2mp ?NhTO @lHyANXOB@`N 9I^#:4?</9:4p ?NzPO3:209:2H//9:4HyVp?NK09:2lp ?NTO/9oNXOBy`|HyvVHy:8 nVfHy`HyHymN3:2mpP?HyNN\O y:8 {f yoRop BHy:4HyLHy9N3:2m/9:4NXO @mHyoHy:4NPO0lHyMNXOB@`0.fHyc`?9|Hy/9IZNP 3:009:0lPHyúHyNPO?9|Hy/9IZNP 3:0lHyNXOBy`tB/9I^Hyp?NK/.?9:0N\O3`HyNXO` 09:2N^NuNV/9D/9/9@HyN09Hg?9HHyN\OHyNXOHyNXOHy9NXOHy[NXOHyNXOHyNXOHyNXOHy NXOHyTNXOpN^NuNV n>fHyvVHy:0p ?HyHy`B nfHyvVHy:0p ?HyHy`HyvVHy:0p ?HyHyN3:209:2l 09:2`f09:0lBy:00. |2<`XHXW PN n]f?9:0NTOp3`09:0Sy:00gzN3:2g09:2Sy:20g\BgNTO` n>f809߈g0N=@0.l ByB@`09߈ny߈g|p?N&TO`x n>g y:0fp`B@3`N 3:2l&`By߈HyvVHyHy?9Hy޶N3:2 y:2g09:2m09:2y߈`pN^NuNVHyvVHy:2Hy:4HyHyN@3:0l y:0fHyNXOp`09:2gHy`/9:4/9I^NPO/9I^NXOT@HйI^#:8HyvVHy:4HyEHy3:09H/HyiHySp?NKNF0fF/.Hyj`B/.Hyp?NK09HAF. p`~09H @cx PfBn096HAj/N.XO096HAj P(H@f096HAj/?< /9I^N g-yI^ n  g n  fR` n :f#GBn yGg" yG !l yGB` RGRn`0.no?.`?././.N 0f"p=@0.f<09H/HyHyp?NKNF0f/.Hy`0.`/.HyNPOB@N^NuNV/By߄BnByY*HyvVHyHy?9߂HyN3Jl yJfhHyNXOp`09J @bH0@R PN09߄g0.fp`B@=@0. |Ɩ2<`XHXW PN` 09J` y߄RyY*`D09gp`B@=@0.H/HyHyp?NKRyY*`p09fp`B@=@0.H/HyHy`BHnHy'HyN^=@l nfPp` /.NXO @mBn n \f nh.g.H0@.}g.H?NTO`.H@ .%g* .&g" .$g .Vg .Mg .Ff=| #I^oHnHyo/.NvV /9I^NXO=@0.H//9I^Hy(p?NK0.o$p`"?9|/./9IZNN @nB@=@0.H//.Hy/p?NKTyY*`NKx yJf 09f B@` 09fp=@`$09H @JtSPop`B@=@ nIf09H @JtTP0.H/HyCHy:`HyvVHnHyIHyDN^=@l nfLHyJ`/.NXO op`B@=@0.H/HygHy^p`HyvVHnHyHyhN^=@l nfHy`r/.NXO=@ n oHyNXO`X#I^o/./9oNPOHyvVHnHyHyN^=@l nfHy`/.NXO=@0.nT@ @ o Hy`v0.T@Hйo#G/./9GNPO09H @Z40g/9G/9oNPO`*0.no?.`?./9G/9oN =@0.H/HyHyp?NK09J_@ @b.H0@: PN`0.fp`0.l`0.nB@=@VyY*` HyvVHnHyHyN^=@ nf Hy`0.l0.`0.H/Hy@Hy3p?NK#I^o/./9oNPOB/9oHyAp?NKp?HyM/9oN 0f09H @Jt=P`~p?HyS/9oN 0f09F`Tp?Hy[/9oN 0f09HAf`/9oNXO0g/9oNtXO=@HyvVHnHyHy`N^=@ nf Hy`X0.l0.`\/.NXO @mF/9oNXO=@0.T@HйI^#G/./9GNPOB/9GHyp?NKp?Hy/9GN 0f09H @Jt=P`~p?Hy/9GN 0f09F`Tp?Hy/9GN 0f09HAf`/9GNXO0gP/9GNtXO=@09JH/HyHyp?NK0.nl y Jg(0.nf yJg0.no y Jfp`B@=@0.H/HyHyp?NK0.H/HyHyp?NK0.H/HyHyp?NK`rHyvVHnHyHyN^=@ nf Hy`$0.mz0.H//.Hyp?NK#I^o/./9oNPOB/9oHyp?NK/9oNXO=@0.H/Hy9Hy+`09H @Zp00.g>09H @fxp0 yoN``BHnHyyHyjN=@m-n#I^oHyoHnNPO0m0.f#I^o yoB n  fR` ngtBn nl N"nRQRn`p?HyzHnN 0fHyoHnNPO0m n  fR` nfn yI^gb?9|Hy/9IZNP =@0.l>HyHyNPO?9|Hy/9IZNP 0l Hy`/9I^?.N\O`-yJB9L n  fR` n  gR`#LFHy/9FNPO/9FNXO yF#F n {g ng yFRF"nR`-| yFRF"nRfBHyLHyp?NKBHnHyHyN=@m-n#I^oHyoHnNPO0mB/9I^Hyp?NK yI^g?9|Hy/9IZNP =@0.l>HyHyNPO?9|Hy/9IZNP 0l Hy`4/9I^NXO6HyLNXOCT@?N TO-@ .gHyL/.NPO/9I^/.NPOB/.Hyp?NK/.?.N\O/.N$XO` y6o BHyPHy:p?NK`?9FN(TOHyQNXO09g\HyvVN$`09H @fxBPBHnHyiHySN=@l`Hy"NXOByB@&N^NuNV/ Ry6096HGjHyL/.NPO&f6/.NzXOB/.HyNp?NKBySy6`Ry yRo SyHy^NXOByB@`096HAj g096HAj/N$XO096HGj/.NXOR@?N TO&g /.096HAj/NPO09H @ZBP09H @fxBP09H @Jt09S@H"@Jt009H @[r09S@H"@[r009H @Z409S@H"@Z4009H @c09S@H"@c009H @oP09S@H"@oP009H @cxp009H @cx1y6p&_N^NuNVHyvVHyyHyxp?HypN=@l0.`N =@l0.` n0pN^NuNV0.H/HyHy|p?NK nfHyNXOp` nf0/9d yY,fHy`HyHyN `0.l0.`< no0. no?.HyN\O`N =@m n0 pN^NuNV nfHyNXOp`H0.l0.`< n o n g?. HyN\Op`N =@m n0 pN^NuNV0.gxHyvVHyHy?9^Hy>N3l yf4HyNXOp`09 @bH0@Ʈ PN`09`HyvVHyEHy6?9HyN3l`HyvVHy:Vp ?Hy^HyFN3m y:Vg y:VgHy`NXOB@`VN 3m` y:Vf p3h`( y:Vf3h`HyvVHyHy{?9HyN3:Tl 09:T`N 3:Vl 09:V`3:TR`HyvVHyHyp?Hy`N3:TmN 3:Vm0.g(py:T?Hy/9ftN Hy/9ftHypS?N7@͈B@9͈`"BgHy/9ftN HyvVHy:Vp ?/9ftHyN3mN 3:Tm0.g?9:VHy/9ftN Hy/9ftHy`PHyvVHyHy?9DHy4N3:TmxN 3mh0.gHy09:TgHy`HyHy`HyvVHyHy?90.g?9>Hy/9ftN Hy#/9ftHy`ZHyjN XO09jgBy>`rp3>`h?.p ?N&TXO`^Hy$NXOp`L3:T\`83:V`,3:T^` 09>fp3j y>fByjp3N^NuNVHyvVHyAHy@?9HypN3l 09`z09 @ bjH0@ PN`ZHyvVHy:Tp ?HycHyBN3m y:Tg$ y:TgHyeNXOByB@`N 3ml y:Tf p3f` y:Tf3fp3`Hy"N XO`Hy.`HyvVHyHy?9HyN3:Tl09:T`jN 3m3:T(`HyvVHyHyp?HyN3:TmN 3m3:TT`>pN^NuNV n fHy`Hy/9I^NPO0. gpHyvVHy/9I^?9HyN3l yf,Hy`09 |2<`XHXW PN`09`HyvVHy/9I^?9@HyN3l`HyvVHyp ?Hy0HyN3:Tl 09:T`N 3:Tm y o y?m y_oT ylH n fp9@`p9@p3`HyvVHy:Tp ?HyHyVN3?9?9:THy:VNPO3m y:Vo Hy` n f09:V` 09:V09`hHyvVHy:Tp ?HyHyN3 n f`HyvVHy:Tp ?HyHyhN3?<?9?9:THy:VNP 3m"3:VH`pN^NuNV09gHyNXON^NuNV0.l0.` nf^HyvVHyHy?9HyBN=@l nfZHyNXOp`Np??.N&TXO`:0.S@ @bH0@f PN09ngN 0.`0.`HyvVHnHyHyN=@m0.H//.Hyp?NKB.A-HB/.Hy#p?NKHy-/./.pC?N7@͈Bn`LHyvVHnHyOHy.N=@l nf4HyP`09ngN pE?/.N&2\O͈=@`HyvVHnHyHyrN=@m09ngN N`HyHy/.pD?N7@`N =@mHyHyHypH`HyvVHy͌HyHyN=@mR/9͌NXO @l nf4Hy`N`pc`HyvVHy͌HyHyN=@m/9͌NXO @l nfHy`vpk͈=@N``HyvVHnHyHyN^=@m/.NXOR@?N TO-@fHyNXOp``/./.NPOHyvVHnHy?Hy6N^=@m$/.NXOR@?N TO-@fHy@`/./.NPOHyvVHnHysHyXN=@l nf/.NXOR@?N TO-@f Hyt`././.NPO/././.pI?N7@͈ .g /.N$XO .g /.N$XO .g/.N$XO`N =@mHyHyHypI`09g09̪f Hy`#͌#͐HyvVHnHnHyHyN@=@l nfHy`B/./9I^NPOB9htHyvVHnHyHyN=@mX/.HyhtNPOHyhtNXO @^o Hy`p3#I^͌p3[pps͈09ngp3R`HyvVHnHyXHy6N=@mHyZHyY/.pU`HyvVHnHyuHy[N=@m/.NXO @l Hyv`N`pT`JHyvVHnHyHyN=@m:HyHy/.pW`xN =@m/9JHyNPO`0.N^NuNV nfHyNXOB@`>0. H//.Hyp?NKHyHy/.?. N7@N^NuNVHyvVHyHy?9HyN3l 09`09f*HnN XO3:Vl 09:V`0.gHyNXOp`3333333333333333`ZHyvVHy7Hy6p?HypN3:Vm*N 3:Tl 09:T`09W@ @bH0@Ǯ PNp` yg yfN 3:Tm yfp`B@3̪0.gBHy509̪gHy1`Hy3Hy-pS?N7@͈B@9͈`,p3` 0.g$Hy@09:VgHy<`Hy>Hy8`09:V33`00.g&HyI09:VgHyE`HyGHyA`j09:V33`0.g&HyR09:VgHyN`HyPHyJ`(09:V33`0.g&Hy[09:VgHyW`HyYHyS`09:V33`j0.g&Hyd09:VgHy``HybHy\`09:V33`(0.g&Hym09:VgHyi`HykHye`b09:V33`0.g&Hyv09:VgHyr`HytHyn` 09:V33`0.g&Hy09:VgHy{`Hy}Hyw`09:V33`bHyNXOpN^NuNVHyvVHyHy?9HyN3l 09`09 @bH0@ PNB@`hHyvVHy:Tp ?HyHyN3:Vp^??9:V?9:THy`HyvVHyHyp?HyN3:Vl 09:V`N 3:Tl 09:T`09H @[r0:Vp`HyvVHyHyp?HyN3:VmN 3:Tm09H @Z4`HyN XO`LHyvVHy:Tp ?HyHyN3:Vp??9:V?9:THyNP 3N^NuNV n,fHyNXOp` nfHyvVHy:X/9$HyN3:Tl 09:T`09ngN BgNTO y:Xg p3:T`#$:X3":T090l$ yo 30`By0p3 yo3(p3By2?9:?90Hy:T/9:XN 3lR yf.HyNXOHy(NXOHyYNXO` yf/9:XHy~` yf/9:XHy` yf/9:XHy`09:gt/9I^NXOT@=@0< n @doD 9I^/0.Hї #G/9:XHy/9GN /9GNz`@/9:XHy` /9:XHy$NPO3"n/9$HycNPON #By2ByB@`t y:To 3:Tn090lp`B@32/9:XHycNPON #09nH/HycHyFp?NKp3N^NuNV0. |2<`XHXW PN`. <p`& <u` <y` <~` <` <N^NuNVN=@0.V@ @b4H0@* PN`HyNXO`Hy`Hy`0.@gHy'`Hy*HyNPO0.@gHyO`HyRHy.NPO0.@gHyw`HyzHyVNPO0.@gHy`HyHy~NPO0.@gHy`HyHyNPO0.@ gHy`HyHyNPON^NuNV0.H//9YlHyp?NK09RH/Hy Hyp?NK09|H/HyHy p?NK09̄H/HyHyp?NKB@9H@B@H@/Hy$Hyp?NKB@9H@B@H@/Hy-Hy%p?NKB@9H@B@H@/Hy6Hy.p?NK09̎H/Hy?Hy7p?NK09̐H/HyHHy@p?NK09̈H/HyQHyIp?NK09̚H/HyZHyRp?NK09̜H/HycHy[p?NK09̾H/HylHydp?NK09̬H/HyuHymp?NK09̸H/Hy~Hyvp?NK09̲H/HyHyp?NK09hH/HyHyp?NKN^NuNV0. H//.Hyp?NK nB@@@H@B@H@/HyHyp?NK09̀H/HyHyp?NK09̆H/HyHyp?NKB@9H@B@H@/HyHyp?NKB@9H@B@H@/HyHyp?NKB@9H@B@H@/HyHyp?NK09̖H/HyHyp?NK09̎H/HyHyp?NK09̐H/HyHyp?NK09̈H/HyHyp?NK np(/HyHyp?NK09̜H/HyHyp?NK09̦H/HyHyp?NK n̦p/HyHyp?NK09̾H/Hy"Hyp?NK09̬H/Hy+Hy#p?NK09̸H/Hy4Hy,p?NK09̲H/Hy=Hy5p?NK09fH/HyFHy>p?NK09ZH/HyXHyGp?NKN^NuNV .f-|Y/.BBgp ?NEj B/.HyZp?NKB/.Hy`p?NO&09<@?p?NJXON^NuNV/.NXO=@0.@ @ n /. n HhNPO0.R@HЮ N^NuNV-|d nR0. nB n gH/./. N6PO-@ ng,/./.N6PO-@ ng/./.N6PO#d͌B/9͌Hygp?NKpgN^NuNVBn 9g/9N$XO/.NXOT@?N TO# 9f"BHyHynp?NKB@`?<,/.HyhN -n 9-@-@Bn n  g n  fR`/.NXO=@ no80.S@0@  g0.S@0@  f0.S@0@BSn` n \fBHnNTXO=@ @o nR0.HH`R nR"nR` n  g nfr nRB0.HAKB 0.H/0.HAKB/Hyp?NKRn ng0 n  fR`-n`2 nR"nR`0.H/HyHyp?NK0.HAKB #KBd0.N^NuNV-|:\n0.@g nRp~n n l" nRp^ nR0. @@@`, nf nRp^ nRp?` nR0. nB-|:\ .N^NuNV nB nf.HyN.XO-@ .g?. /./.N 0. S@0@BN^NuNVp=@0.lrHyNXOBgNTO@.H |62< `XHXW PN`HyNXOp`HyNXOBn`HyNXO`0.N^NuNVp?HyPN\O0.H/HyHyp?NKp?NTOp?NTO09Pg HyBBgp?NEj Hy`HyNXOp?HyPN\OB@N^NuNVp?NTOp?NTOHyNXON^NuNV0.H/HyHyp?NK09BfBHyNXO y .fvHyvVN$XO09Y,f^/9JHy.`FN0Hy3|NXO?9BNTO=@0.lHy1NXOHy09Ry @MoHy NXXOByp.?NTORR`N^NuNV n gB n g:09Rg09lf098f09Rg09pg 09xgp/.NXO=@0.S@ @bH0@ PN`@pP?/.Hy:dN p3`pP?/.Hy:N `pP?/.Hy:d`0. @bH0@ PN nY g nD fBgNCpTO`09Ry @MoHy NXXOBy nZ f yRg|?. N`p?NTOHy NXXO`RHy NXXOp??NTO/.`"Hy NXXO`0.y09 @MoHy NXXO3/.N`Hy NXXO/.NXO3`0.y09 @MoHy NXXO3/.`2/. /.Hy HnNHn`\Hy `RpZ?NCpTOZy09 @NoHy NXXOHy NXXOBy yRfpZ?NTOp3`y 09 @NoHy NXXOHy `y09 @NoHy -NXXOHy .`y 09 @NoHy =NXXOHy >N`jHy INXXOHy JN`4Hy RNXXOHy S`y 09 @NoHy ]NXXOHy ^`Hy lNXXOByN^NuNV09ng/.BBgp ?NEj B/.Hy p?NO&N^NuNV09Hg4BHy Hy p?NKB9I$ByHp?NTO09LgB9dByLp?NTO09NgB9[vByNp?NTO09Pg4BHy Hy p?NO&B9ZByPp?NTOp ?NTOp ?NTO09|g^?9|Hy /9IZNP =@0.m80. @IZ PBHy ?.N\O @o p?NJTOBgNTO09ng/9$HycNPO3"nN0NN^NuNV0.H/Hy Hy p?NK0. H/Hy +Hy p?NKNIj n f?.` 0. n?NTON^NuNVHy͌# ?͐ByrByZ2 yj~o@"yIb Q -g2"yIb i -g" yIb/(NXO o Syj~XIbSyj~oXIb09j~H/ yIb/Hy @p?NK"yIb Q =fB@`j"yIb Q -f6"yIb Qh.H?NSTO0lp?p?NJXO`tN`09Z2H/Hy MHy Fp?NK09nf ycZ2g09rgHy NN6~XO y͐g, ysZ2g" yrZ2g yvZ2gHy aN6~XO yvZ2f.09Tg&09nfp?N2TO0gHy zN6~XO ysZ2g yvZ2g yrZ2g yxZ2f&09ngp3R09TgByRp3l09lgByR09Z2N^NuNV yIb R-@0.g0.@C @7b\H0@ PN`XXIbSyj~ yj~m"yIb Q -fHy N6~XO yIb#̈́`p3` 09Z2gHy N6~XOpx3Z2`09Z2gHy N6~XOHy Hy Hy pF?N7@`09Z2gHy N6~XOpv`09Z2gHy N6~XOp3T`09Z2gHy N6~XO n(gHy )N6~XOBnBy 9IbX#dSyj~o~XIb"yIb Q -f Hy L yIb/NPO0fPRn` yIb/NXO n( yIb/N:XO0g yIb/N'XO0oRy`|Ryj~YIb yl0.fHy NN6~XO noHy ^N6~XO nf09oHy oN6~XO09f&BgN2TO0gHy N6~XO`p3V09H/Hy yIb/p?NKps`09Z2gHy N6~XO n(gHy N6~XOXIbSyj~09j~g"yIb Q -fHy N6~XO yIb#͌pr`p3r`vp3t`jN09fZp?BgNJXO n(gHy N6~XOXIbSyj~ yj~m"yIb Q -fHy/N6~XO yIb#͐`p3` n(gHyBN6~XOXIbSyj~ yj~lHye`By2 n(gHy|N6~XOXIbSyj~ yj~m"yIb Q -fHyN6~XO yIb/HycNPOHyHycNPO0gp`B@3n nlfBg?90HynHycN 0lHyN6~XO/9HyHyp?NKN #` n(gHyN6~XOXIbSyj~ yj~m"yIb Q -fHy N6~XO yIb/NXO-@p //.NPO=@?.N TO @o #`(Hy` n(gHy6N6~XOXIbSyj~ yj~m"yIb Q -fHyYN6~XO yIb/NtXO=@ n o20.y^n&0.3\3Z n^op^3Z`Hyh`t n(gHyN6~XOXIbSyj~ yj~m"yIb Q -fHyN6~XO yIb/NtXO=@ n l3f nop3̰`Hy`p3^`Byjp3>`p3l` n(gHyN6~XOXIbSyj~ yj~m"yIb Q -fHyN6~XO yIb PH=@@e @b H0@ɞ`3`FBy`>Hy`.p3$p3&p3(ByP`By@`Hy N6~XOR nH=@`nB@N^NuNV/0.H/Hy Hyp?NK0.@ @bH0@ʺ PN`09gHy NXO?9 nQf"N 3<0l 09<0`N|`0.fHN 3<0mHyeHydHycpL?N7@͈09ng.N `$ nfHyvVHyyHyf?9HyN3<0mdN 3<2l 09<2`r09<0@gN `B@3<209<0@g0By<0 y<0l0y<0BRy<0`#J09<2fp3` n*f,BHy<4HyHy~N3<0l2` nfN 3<0mNT$` nfN҈` n\fN$2` nfHyvVHyHy?9.HyN3<0 y<0fHyNXOp`:09<0m N 3<2m?9<0NTO3<2 y<2fp`B@309` n;g n9f?.N` ng n7g nXg nYf?.N`^ nGfBHy<4HyHyN^3<2l y<2fHy`HyHy<0/9<4Nf 3<2mN 3<2m?909<0H?NXO0lHyNXOBy`L nf N6` nf N(` n<f N` n@g n f n@f < ` < #<4HyvVHy 9/9<4?9zHy N3<0l y<0f(Hy :`N 3<2m?9<0?.NXO` nCf09fN 3<0m` n2f209|fHy NXO`By<209<2y|ln09<2HAP09<2 "@IZ 09<2HAP0<209<2HAP09<2 "@IZ0Ry<2`HyvVHy Hy ?9|HyPN3<0l y<0fHy `HyvVHy<4Hy Hy N3<2mf/9<4?9<0N\O @mp` n g n_fHyvVHy<4Hy! n fHy `Hy N3<0mJ y<4 {fB/9<4NXO3<009<0S@0@<4 }f09<0S@0@<4BR<4 n_f"p?/9<4p?Hy!N `6/9<4Hy!NPO` nDf N` nfBHy<4Hy!$Hy!N3<0mvB/9<4Hy!%p?NK y<4 {fB/9<4NXO3<009<0S@0@<4 }f09<0S@0@<4BR<4B/9<4Hy!.p?NKBy<0By<2 y<4<0g09<0o y<4<0 Bg6 y<4<0 bg$ y<4<0 Lg y<4<0 lfn y<0f09<0S@0@<4 \g6 y<0oD09<0S@0@<4 \f.09<0U@0@<4 \g09<2Ry<20@I^p\ yI^<2"y<4<0Ry<0Ry<2`09<2Ry<20@I^BB/9I^Hy!7p?NK09<2R@HйI^#<4/9I^NXO20< AS@3<009<0H/Hy!LHy!@p?NKHy<0Hy<4/9I^NvV 0ml09<2R@HйI^#<4B/9<4Hy!Mp?NK/9<4NXO` ng n>g n]f?.NB` nfHyvVHy<2Hy<4Hy!dHy!VN@3<0l y<0fHy!e`b09<2g Hy!`P/9<4/9I^NPOHyvVHy<4Hy!Hy!N3<0m0/9I^/9<4N5PO0g.B@`* n3f"N 3<0m/9 N:hXO` ng n ffHyvVHy<0p ?Hy!Hy!N3<2l y<2fH3<<0N 3<2m.p??9<0NJXO nOf"N 3<0mXN pa͈` n f(N 3<0m.Hy!Hy!Hy!pF`R nHf Nb`* n fHyvVHy͌Hy"Hy!N3<0 y<0g y<0g y͌ {fB/9͌NXO3<009<0S@0@͌ }f09<0S@0@͌BR͌N3<0`\ nVf?.NԞTO`^ nfHyvVHyTHy"#Hy"?9RHyN3<009<0H/Hy"7Hy"(p?NK y<0fHyTN XO3<209<2H/Hy"NHy"8p?NKN,09<2 |2<`XHXW PN`,p`"p*`p.`p `/9JHy"ONPOp3<0?9<0N` n[fHy N`( n^fHy \` n+f2N 3<0mN( @op`B@3<009<0` n/fHyvVHy<4Hy"eHy"_N^3<2l y<2fFHy"f`pp2?/9<4HyON N 3<0mf#O<4/9<4Np`P n-g nJg nIf?.NJ` ng n8f?9Hy"|/9ftN HyvVHy<0p ?/9ftHy"N3<209<2mn09<0np3<0HyvVHy<4Hy"Hy"N3<2m2 y<4 {fB/9<4NXO3<209<2S@0@<4 }f09<2S@0@<4BR<4 nf0B/9<4Hy"p?NK/9<4?9<0NTT`.B/9<4Hy"p?NK/9<4?9<0NX\O309H @[r0g09fNF09g09f nfHy"NXO n8fHy"NXO` n.fJHyvVHy<4Hy"Hy"N^3<0l y<0fHy"`N `T nfnHyvVHy#Hy# ?9HypN3<0 y<0f Hy#`09<0m?9<0NBTO3<009<0l` nf##.͐HyvVHy<4Hy#YHy#/NR3<0 y<0gL y<0g@N 3<0m0/9<4/9I^NPO#I^͐09<0H//9͐Hy#Zp?NKpv͈09ng`p3R`T nfRHyvVHy#Hy#g?9nHyN3<0 y<0f Hy#`f?9<0N~`Z nf N8` ng nfT <##͐#͌HyvVHy<2Hy<4Hy#Hy#N@3<0l y<0fHy#`p3/9<4/9I^NPO?<,/9<4HyhN nf09<2H/Hy#Hy#p?NK09<2f HyvVHy͐Hy$Hy#N3<0m`#I^͌B/9͌Hy$p?NK y͐g*B/9͐Hy$p?NK` 09g09̪f Hy$`<09<2H/Hy$GHy$Hy&N.XO-@f-y/9<4/.Hy&/9I^NN 3<2mV/9I^` n4fJN 3<2m2?9?96?9Hy&N 09lHy&Hy&NPO`09HAf??9Hy'!NPOBy<2 y <2l?9<2Hy'BN\ORy<2`By<009<0yn~?9<0Hy'FN\OBy<2 y <2lP29<2H09<0(ЁA[#<4 9<4g/9<4`Hy'RHy'NNPORy<2`Ry<0`vHy'YN` n?fbN 3<2m/9D/9/9@Hy'[N09Hg?9HHy'oN\O` Hy'tN` n'flHyvVHy<4Hy'Hy'vN3<2m\Hy'N.XO-@f-y$/9<4/.Hy'/9I^N` nAfHyvVHy'Hy'?9HyN3<0l y<0f*Hy'NXO`HyvVHy<4Hy'Hy'N3<2m y<4 {fB/9<4NXO3<209<2S@0@<4 }f09<2S@0@<4BR<409<0 @bH0@ PN/9<4?9<2N\O3<0lnHy'NXO`\0.H/Hy'Hy'p?NK`P09H @cx PfBBHy<4Hy sHy ]N3<0mN 3<0mNF`09H @cx PfBHy<4Hy Hy tN3<0m/9<4NV`N 3<0l`lp3<2`p`p`p`p ` y<0f/9<4Hy'Hy3N `/9<4Hy'NPO09f" y<0fHy'Hy3N PO`Hy'`p&N^NuNV/ Bn09nfHy(NXOB@`& 9l092fHy(`09LlBHycHy(p?NKBg?90HynHycN 0lJHycHy(HyDN HyDNzXOBHyDHy(p?NK`RBy( 09lfHycHy(NPO o09lf/9Hy) NPO09lf?9*?9*N: TO/Hy)N Hy)ANXOHy)xNXO09Ng8Hy[vHy)NPO09gHy)`Hy)Hy)NPO09JgHy)NXO?9*NTO0l Hy)`B09fH/Hy*Hy* p?NK09H/Hy**Hy*p?NKBy(?9P/9Nz\O0lN0Hy*+`09*H/Hy*nHy*Vp?NK?<N TO#Df Hy*o`p3.p3(09(g. 9(g$ y(R(B@@=@f|B(`p?p?NMXO gbp?p?NMXO=@09n 9(f.0.H @c g0.H @c#(`j yc|B@=@=n0.g?.NTOBn` 9(f80.@y*f(0.H/Hy*Hy*BgNKRn`09"g yff0.@gL09(f&y'R'p?N~,TO y''c #D8'Ry'p3(`H y(f>&y'R'p?N~,TO y''c #D8'Ry'By( nfp3( nfBy(09fn&y'R'?.N~,TO y''c #D8'Ry'09(g09Jg?.N: TO/NXO`0 y'R'0. y''c #<8'Ry'09Ng(=n09f n fp =@?.NTOp?p?NMXO gp?p?NMXO=@09Jg?.N: TO/NXO`09fn09"g0 nf p3(` nfBy(`09(gn09n y'R'0. y''c #<8'Ry'09Ng:?.`*09'gTp?p?NMXO gD y'R'H=@ y''c #<8'Sy'?.p?p?NM\O`09'g$p?p?NMXO g y(R(H=@ y('c #D8(Sy'?.p?p?NM\O`N009( g?9 ng6?.p?NXO0l"Hy-fNXXOHy-gNXXOByNN^NuNVB@N^NuNVpN^NuNVpN^NuNVpN^NuNVpN^NuNVpN^NuNVpN^NuNVpN^NuNVpN^NuNVH *nz~H< @ g F fR` F-fz` F+fRH< @0m F9n2A00 A>`JEf0D@>0L N^NuNVH *nBEB@H.H< @ g F fR` F-fz` F+fRH< @0m$ F9n6Hp //NTPO0.`JEf D. L N^NuNV/.NXO/NXON^NuNV/ *ngR/ NtXO.`g .f/ NtXOS@._g .f/ NtXOS@.^g :fgR/ NtXO.dg .f/ NtXOS@.cg .f/ NtXOS@.bg :fg/ NtXO.\g :fg/ NtXO<3-*_N^NuNVH0Hy.fN.XO*@.Xg#.XB-I-g :g .d`Bg :fpNXO/ NXOL0N^NuNVH0*n(n ,H<f,H`R,H0-m A>0o0o_G`^GSFn`*0- @l?0-R@?NXO:El^G`_GRFm0L0N^NuNVH *n9.g9.^H0-Am9.^H0-Af8Hy.^/ NDPO>0-Gg 0-Gojp`h9.\H0-AmV`9.bH0-Am9.bH0-Af4Hy.b/ NDPO>0-Gg 0-Gl`9.\HS@mnB@L N^NuNV/ Nt n --@HnNXO*@/NXO0g.r29- n -Ё-@HnNXO*@p;@ *_N^NuNV nf?. NTOJ@gp`0n.oHN^NuNVH8&y< g.*[ g((nHHAfJgR`Jf -=f `BL8N^NuNVH8..P b46d.946/N,XO*@ Mg`J/ f&M #/#.`& y/ f QP&m`(y/ Q L&h)M Q@* Ѝ#/ (@Q LB)KL8N^NuNVH0~ .\S@,dB`ƙ*y. gr .gH g @є .*L(Mc2  d @*`* Ѝ#. y. X`dJg @Ѝ*@`*m.f g#.Ry/09/ @e Sy/`X/NxXO/.NXO*@Sy/ L0N^NuNVp0./NXON^NuNVH .Y*@Jf4~0G/Jg 0RG0@/H?p?p?NM\O`N`L N^NuNVH0*n09:y0bd09:H@B@H@ @/R(P`(|/$ g$/<3/ N PO/<3/</5N PO/<3/ N PO/<3/</8N POL0N^Nu O$X"XHB@Nu o0/L.NuNV/<p0./NPO/NNXON^NuNVH..p//NPO.N,NȐeLN^Nu"o o JfSfNu"o ofJfHHNu"o o fNu o"Jf S@Nu"o oB2/ gSAfJgQHHNuE Z "Z2gSAWSAmtQNuNVH0#2/<2N.XO#2f #22/<2N.XO*@ f*|2p?/92/ N (@ g/9 @%g0gP/.? n hN\O`p =@p=@p=@H> G-fp=@H>`Bn G0f p0=@H> G*f& nT=Plp=@0.D@=@H>`*Bn G0m G9n0. G@0=@H>` G.fJH> G*f nT=PH>`*Bn G0m G9n0. G@0=@H>` Glf&H> Gdg Gog Gug Gxf0@> `-@*@p=@0 |˔2<`XHXW PN`4 nT=P0.l0.D@=@p-p ??./ NPO*@`p ? nT?`p`p` n-PX .l .D-@p-p ?/./ N `p ? n// N *@X`p`p`/ ?./.?N~ *@P`fBn n-Pf-|3X .-@*@g0.m noS`(Bn nT0` n//.N"PO`n ./0.Hї =@lBn0.fL0.g0 n0f( n -f/. nRH? n hN\O0.Sn0g /.?.` nd /. nRH? n hN\O`0.g0.Sn0g/.?. n hN\O`L0N^NuNVH >. *NB%0<g"0H@H@B@H@ @>`?Bg _g nR` .L N^NuNVH0*n>.IB$p0//. NPO-@g$p0//. N POA-n ` n g` L0N^NuNVpL?Hy3p?NPOp?NTON^NuNVN~N^NuNVH >. *nSGo"/. n hNXO< @g 0 @ fB Ff fB` .L N^NuNVH0*n(n g/ H? lN\OR`L0N^NuNV/ *ngHy3|H? y3N\OR`Hy3|p ? y3N\O*_N^NuNVH0*n(n0. =@,g/ lNXOSn ,f,f 0.gL/ lNXO> @g:Sn`?./ ,H?NPO>on`0f,`,0. n L0N^NuNV/ *nBgB/ NN *_N^NuNV/ *n-g / mNXO/ NXO @fp`D?./. -H?NRPO-@ g -g0.@H@B@H@Э*+@B@*_N^NuNV/ K34d. g U(fp?//. /.N*`X`B*_N^NuNVH0*n(n -f +L-L0N^NuNVH *n-fp`-H?NTO -g-f /-N$XOB-0L N^NuNVH *nBm -ff >o?/--H?NPOGf$0m mAf -*+@`+UB@` 09:H fBy:`-pL N^NuNVH *n>.|BnBnp=@ n R pr@H @rf|pw@ n g,H @bf"BnR n gH @bf$Bn0l0.f?/.Nz\O>0l@0.f0.g4?</.N*\O>m Fg?NTO?/.Nz\O>0m0.gp?B?NRPO-M .fp?N TO*@ f ?NTO`|p@0.g- p+@*+@Bm +|^+|G `DH @wfRn`H @af&Rn`H @+g.HHAf|`BL N^NuNV/ *n .*+@+|RB-0. D@;@ m l;| +|8`+| *_N^NuNV/ *n Sm lBm p` UR0.*_N^NuNV/ *n UR0.*_N^NuNV/ *nRm oBm p` URB@*_N^NuNV/ *n -f,-f?<N TO+@f+|+|`j-f2-H?N2TO0g3|f+|+|~ -`&+|+|v-H?N$TOHЭ*+@Bm *_N^NuNV/p?B?.NRPO. fB@`0H@.N^NuNV/ *n/ NxXO/ mNXO*_N^NuNVH >.*n / NxXO/ ? mN\OL N^NuNV/ K4Y M3e g/N:XO`*_N^NuNVN?.N`TON^NuNVH *nRm o/ NXO0f ~3fHy3|NXO -?/--H?NPOD@;@ @fZ09:H fBy:`-Bm `B0- Rm m+H URB@>-g G gP Gg 0`0- f-pL N^NuNV/ *n ~3fHy3|NXOBm p?Hn-H?NPO @g,J@gH .f-f8 . f-fB@.`(09:H fBy:`-`-p*_N^NuNVH >.*n G f -g/ p ?Nv\O @fp`0Sm l"/ NXO0f -S@;@ UR0L N^NuNVH >.*n G G f-g/ p ?N\O @gZBm -fN/ NXO0f@p?Hn-H?NPO @f0` 09:H fBy:`-pL N^NuNVH >.*n G f -g/ p ?N~\O @fp`?NAXO/N(XO`B@N^NuNV/Bg/.pl0H/N(XO`"?.N4TO=@m?.?NXO0.N^NuNV/?.?. rF?NA\O>0f(?.N4TO=@m?.?. NXO0. `0H/N(XO.N^NuNV?.N4TO @Cfp`B@N^NuNV?.?./. pB?NA /N(XON^NuNV/?. /.p=?NAPO.m:0H.mpF?0?NXO` m n0?NTOH./N(XO.N^NuNVH A#4,/94,NXO0gB4,p 3:p`?.N4TO @CfzB@9D>B@9DHD*@SnmSGl^pQDB9DHyDp ?NA\O>mp ?p?p?NM\OpDB@9D>B@9DHD*@0Gp H< Ff~` n R RE F ft DDDB4,0`0/. 0.H/?.p??NA >B4,0H/N(XOL N^NuNVH.. l <`0 f 9`$R @./pH?NA\O,g Ї# LN^NuNV0.H/N,XON^NuNVH0*y4, g (ydp gp$?NTOp?/ N\OBgNTOL0N^NuNVH0>.*n Gm G0m <` 9EPfHy?<p?NMPO#EPp/?p?NMPO(@0HAN f0HAN `$f0HAc(Pf8|-M .f<0HAN/?p?NMPO0HANB0HAcB`HfK0HH@B@,-M0HAc  /?p?NMPO L0N^NuNVH>.0fD 9EPg/9EP?<p?NMPO~ G0lx0HAN,g /?p?NMPORG`Hy?<p?NMPO#EP <,~ G0l(0HAc g /?p?NMPORG`LN^NuHHzB>?@c @ P B@ᘰWfN U@g S@gLNsLPONsNu o0/|L.NuNVH0*n(n H>g HGgB@`pL0N^NuNVH8/94 NXO@> .g(&n*S gHy4/ NPO0fRGfX`&n *S g RGfX`0@@0H/pH?NA\O(@-@fp` .g&&n*S gHy4/ NPO0ffX`K4fS*y4 H<g`-L&n *S gfX`B gR-Lp*nfg" nAcg`R Mgp ` nAcB`BgNTO/././.BgpK?NA*p?NTO/.pI?NA\O/N(XOL8N^NuNVH *nHH. :gB@`Za  e  d03EX2p4. 9ETfp?NATO?p?NAXO#ET ETL N^NuNVH *n CExA1!2<!!Qp/?NATO-@Hnp?NA\O?</.pN?NAPO>/.p?NA\O0lr/.NXO0g n (\fT n \g n .f, n(g n (.f n(f p;@B@`0H/N(XO`.H;@+n=n=nYO/.NXO/NPOC I/ / N6PO+@+@+@.HA.HHA:.HA.HHA;@0L N^NuNVHN. 94f>Hy/NPO&YONJ/NPOC I/ / N6PO#4Hy/NPOй4, .g n LN^NuNV/.pA?NA\O/N(XON^NuNVHYO n /(NbPOC I/ / NPO/N>XO-@=n=nBg/.p=?NAPO>p??HnpW?NA ,?p>?NAXO/N(XOLN^NuNV/A#4,/94,NXO0gB4,p 3:p`,/. 0.H/?.p@?NA .B4,/N(XO.N^NuNVH >.0V@ @bH0@ PN`*pP`&pA`"pC`0m*y4 SGmfp`gHL N^NuNVH >.0m*y4 SGmfp` g0. L N^NuNVH >.0V@ @bHH0@ PN*y4 HGg fp`&R` 4 ?NTO`~C`~A`~P`pL N^NuNV .l .D3:p` .N^NuNV/p?NNTO. 3Ex ?3Ez 3E| 3E~ S3E P3E <Ex.N^NuNVH ..KE : ?: : : S: P: <EL N^NuNVH *n 0%@PH.0%R@Hހp0%ހp0%ހp0%ހ0%@Hހ L N^Nu"o`C"/jD$jDA`|J/jDJk`JjDNu$/` o$"/A`NNu"o`C$jD"/jDA`, gJ/jDNu$/` o$"/A` NupJfpN∲cd⒒d҂dFN o"`"/ jD$/jDD$@A`" jDNu o"`"/ _$0"@0HAHBЁH@B@ЉNNVH *n>. H0HHAf `fBL N^NuNVH0*n>. (Mfc%H0HHAf `BL0N^NuNVH8*n(|4:0- > @e~0GGH@B@H@4T&@p 0-> @ e~0GGH@B@H@4j&@p 0-> @ e0 @0`p 0 H@@0p 0-> @00 H@@0p:0-> @00 H@@0p:0> @00 H@@0p 0- @l>JGl p-@0D@>0@00H@>0d@00dH@>0 @00 H@@0p B <4:L8N^NuNVYO n/NbPOC I/ / NPON^NuNV0.@f, n.m 0.HdH@J@f0.HH@J@fp`B@N^NuNV/<Q .%=/NTPOЮ N^NuNV/<Q ./N PO-@/<Q/.NPO%=-@CA$H$$N^NuNVH *|E..,.   QmQRBmp/ R/NPO;@ * #o@/<7Ipd//NTPO !%Y/NPO*p//NPO" ЅR* (/<pd//NTPO//NPO;@ pd//<0- H/NTPO/NPO/<Q/<'/NTPO/NPO;@/<'/<Q0-H/NTPO/NPO& ;@ mm"<`r@ ;@ m op `pm mo0<l`0<km mo?- NTOJ@gRmp0-R@< FnSGF 4HHBBB2-H0HH . o4H…2HdpAB:`zpd//<0H/NTPO/NPO(/<'/<Q0R@H/NTPO/NPO&0-EHЄЃB-@pg G,g F.d`Ec ,\g F.dp\H<g F.d`F.dB?./<ENt\OJ@lJGfBL8N^NuNV094g094`p?NNTO34N^Nu R \ ` d< hx l p t x |  2|222236223~223JTJ^JhJrJ|JOONNOlPOZZ0ZZ0_J_R_~ktkkkkkll,lHkktkkkkkll,lHk,ld-lz.l6l7l8l9m:m&;m<mRmmn nPnrne~tm~o~s~e~Jx,emos&e<^ p f BނނTj˒˰@Lͤͮϊ`Pv*ռ؆fD8:܄.RTФrVHVVLL&&D(   P      0123456789DOX&dox&0.  +- FV^nDNb 4>RDpz:DNXlvfv0b\ (& fX:>lNH*0!!!"# ""# ""$!# !# "B# # # # "# "# """"# # # ""!!x"# ## !!# "8"# # !## # !!!# !!# # # # # # # "# # # # ".########$ $ $ #$ ##$ #$)'( '` ''(''('('('("'P*(,'.*l2(3(?(t&x+++D,-'+P4,6,7+&-^-@-&5: 5H 5+6B&&....3~34N#4(.8&:8:B:L12l.. .$0n%//0dD12CCCCDD4DLDdMVMdMrMijjd@hohiiia"jlmlaon n `occVgZjhep.pjprp(rsstt0p\rFrPtJr(qssr2p(t@s trtttttuFubuvv$ss${B%wH&wFxM{BV{Bfxm{Bv{B$}!v#z:~;z@v!dt&FfffPn^4444Fh44444 *, ,!#$%&()*+-/<>@^|~Rh4o8q8t<x4hH(((((((#+¾-< >@|#Z<ߦߎ00"߲ߚ>]2x>0\ H-IJR-(PF4n@J\Nl r 0 !.!!""v$&&&$(&&%<&%z%)R))****)*((*****Z)R++T+,,"/e/zm/o/s///// ;F ;F ;FN;XQ;XY;Fn;Xq;Xy;F ;l>@AbA A2 A2A2A@A>B@EAbFARA2XAZ@a>b@eAbfArA2xAz@AfGH,HXHHHHEF I&F(F8GFRFFFGG@GfGI&I&LFM|MMN"N4NdNO\OOP4PPPQ0[2[D[D[D[D[D[D[D[2[<[2[D[D[D[2T,[t[t[t[t[t[t[t[t[t[t[t[t[t[t[tTn[t[t[t[t[tW[t[t[t[t[t[t[tW8XW[YfTVWZ[tTW[tW[tZZTU[L[tZZTzW[l\\v\v\\v[\ \\!j#j&j:j;j!j"||*|.|2|:||6|:em6o&s.eD.8 !0?@b.ch8qNsdDOLU,XPcdeTfTgTorsruxDL0123456789ABCDEFZ^b*(?@@J_~*RͬZZZZZ#@#@  &Y~   ##~abC-Kermit 5A(189), 30 June 93C-Kermit Server REMOTE Commands: GET files REMOTE CD [dir] REMOTE DIRECTORY [files] SEND files REMOTE SPACE [dir] REMOTE HOST command MAIL files REMOTE DELETE files REMOTE WHO [user] BYE REMOTE PRINT files REMOTE TYPE files FINISH REMOTE HELP REMOTE SET parameter value Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. Can't initialize!Can't allocate i/o buffers!%s: Can't open device aux:Can't allocate packet buffers!cl_commandsckcmai got interruptckcmai setting interrupt trapgetiobs ok^уѕњџAtari ST tty I/O, 5A(086), 29 Jan 92 Atari ST GEM 1.0aux:con:aux:ttopen, ttyfd lclttclos ttyfdttclos about to call ttresttclos donettpkt flowttpkt speedttpkt flowttpkt carrierttvt ttyfdttvt tvtflgttvt donettsspdSPEEDBAUDttxin nttinl maxttinl timottinl timout with^C... ttinl got eolgtimerconbinentering conresconres isatty ok ttscarrӈӬӾ ;Zx0Nh'GEM file support, 5A(059) 16 Jul 92 Atari ST GEM 1.0rm pwd ls -l ls -l cat df $cwddf echo just we frogs zopeni fpzopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinrb zopenizopenizopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULL fp[]=stdout fp[]=stdoutwabzopeno can't open fp[n]zinfill errnozinfill ferror zoutdump charszoutdump write okzoutdump write errorzoutdump write returnschkfn: file number out of range?File number out of range - %d zchki stat failszchki skipping:zchki stat ok: access failed: access ok: lengthMalloc error 46 izchko access failed:zchko access ok:zrtol:zstrip beforezstrip afterzltor name2zchdirHOMEzchdir 2zchdir 3zchdir 4zchdir 5HOME.\ck >rzxcmd fpzclosf filnumzclosf fp[filnum]zclosf fp[ZSYSFN]zxpand entryzxpand okzxpand fgen1zxpand fgen2 okzxpand 2 not okznext*.U1zfcdat stat failedzfcdat date failed%04d%02d%02d %02d:%02d:%02dzfcdatzstimeBad creation date zstime date check 1Bad creation date zstime date check 2Bad creation date zstime date check 3zstime yearzstime yearzstime entering switchBad creation date Bad creation date Bad creation date Bad creation date Bad creation date Attribute creation date ok Can't stat file:Can't set modification time for file: Modification time is set for file: zstime comparezstime comparepacket\\pr %s >prn:echo%s %ssplitpathsplitpath mallocmalloc fails in splitpath()C-Kermit functions, 5A(089) 11 Jun 93encstr string too long for bufferencstr string too long for packetputfil zchout write error, setting czseengetpkt: empty stringgetpkt: input errorgetpkt: empty filegetpkt zminchargetpkt fmaskgetpkt new rtgetpkt leftover osizegetpkt eof/eottinit getsbufTransaction beginsGlobal file mode = binaryGlobal file mode = textresetc fsizesinit: no memory for cmargbufsinit nfilssinit cmargsinit cmarg2stdinsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamsinit cmdstrTransaction beginssinit oksipkt pktnumsipkt ksipkt getsbufxsinit kNONAMErcvfilrcvfil cmarg2Receivingrcvfil asrcvfil existsrcvfil appendrcvfil backuprcvfil backuprcvfil rename failsrcvfil discardrcvfil renamercvfil overwritercvfil updatercvfil bad collision actionrcvfil: xnamercvfil: nreof fncactreof discardreof discardingmailed toprinted with optionsreof returnssfile pktnamsxpackSending as mode: binary mode: textSending from:SFILE fsecssdata entry, first drainsdata draining, winlosdata sbufnumsdata countdownsdata packetsdata cx/zseen, drainsdata eof, drainsdata ttchk *** interrupted, sending discard requestseof can't get s-buffersxeof nxtpkt failssxeof packetrpar 8bq sqrpar 8bq ebqrparentering sparspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar lscapuspar yspar lpcapuspar lp lenspar lp spmaxspar windowspar window after adjustmentspar windowspar no windowsspar sending, redefine spsizgnfile sndsrcTransaction cancelledgnfile czseengnfile nfilsgnfile cmlist filnamgnfile zxpandgnfile donegnfile znextgnfile skipping:not sent, reasonDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremsetadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new len !"$'(+-.03569:(resend)RESEND PKT NOT IN WINDOWRESEND kresend pktinfo indexToo many retries. retry(resend)(resend)entering rpack, pktnumrpack getrbufrpack: ttinl failsrpack ^C serverrpack ^C en_finrpack packet length less than 3rpack bad sequence numberrpack echorpack bctlrpack chklenpacket sticks out too farrpack block check Bchecked charsblock checkshould bechecked charsblock checkshould bechecked charsblock checkshould bebad type B block checkrpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d-End of transaction files total file characters communication line in communication line out elapsed time (seconds) effective data rate efficiency (percent) end of file file characters communication line in communication line out W#Z#Z %ini_pkts: no memory for s_pktini_pkts: no memory for s_pktinibufs sizeinibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmksbuf makebuf returnmkrbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf, packetgetsbuf, sbufnumgetrbuf rbufnumgetrbuf wslotsgetrbuf dum002getrbuf dum003getrbuf new rbufnumgetrbuf foulupfreesbuf sseqtbl[n]freerbuf, slotfreerbuf no such slotfreerbuf, packetfreerbuf, new rbufnumfreerpkt seqfreerpkt kfreerpkt freerbufchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%5d%6d [%.72s%s] ...free: %d, winlo: %d %ld%ld%dsattr pkt too longsattr spsizsattrsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsizeunknownrsattr: refusedrefusedgattr file typegattr restoring binarygattr attribute A = textgattr attribute B = binarygattr encodinggattr unk encoding attributegtattr: no memory for dsbufgattr: no memory for spbufgattr length%ldgattr fsizegattr returnAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena discard as mode: binary mode: text opena charsetCan't open output fileFailure to opencanned: cxseen czseenopeni sndsrc file numberauthorization failure openi authorization failure ok zopeni okcould not be opened openi failedopeno: name open cancelledauthorization failure openo authorization failureopeno failedFailure to openopeno ok, nameopena restoring binaryclsof dispclsof restoring binaryFailure to closeDiscardedDiscardedIncompleteIncompleteClosed444444444444444444444444444444444444244444444444444444444444444444444444444434444444444444444444444444444444444444444444444 4444444444444444444 444444444444444444434444444444444444444444444444444444444444444%442!44444444444444444"444444444444444444443444444444444444444444444444444444444444444#44$244444444444444444444'4444444444444444443444444444444444444444444444444444444444444444&244444444444444444444(444444444444444444344444444444444444444444444444444444444444444,424+4444444444*444444)44444444444444444443444444444444444444444444444444444444444444444424444444444444444444-44444444444444444443444444444444444444444444444444444444444444444424444444444444444444.44444444444444444443444444444444444444444444444444444444444444444424444444444444444444/444444444444444444434444444444444444444444444444444444444444444444244444444444444444440444444444444444444434444444444444444444444444444444444444444444444244444444444444444441444444444444444444434444444444  44444444444444444444444444444444444424444444444444 44444 4444444444444444444344444444444444444444444444444444444444444444442!444444444444 4444" 444444444444444444434444444444Wart Version 2A(009) 14 Jan 92C-Kermit Protocol Module 5A(055), 4 Jun 93User cancelledSEND disabledRGET disabledBadly formed server commandREMOTE HOST disabledCan't do system commandQUIT disabledDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledCan't change directoryREMOTE DIRECTORY disabledAccess deniedCan't list directoryREMOTE DELETE disabledAccess deniedCan't remove fileFINISH disabledBYE disabledCan't send helpREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPE disabledAccess deniedCan't type fileREMOTE SPACE disabledAccess deniedCan't check spaceREMOTE WHO disabledCan't do who commandQUIT disabledUnimplemented REMOTE commandCan't transform filenameCan't open windowCan't open windowNfile collision settingXError writing dataCan't open fileXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileCan't execute commandCan't open file stored asCan't send attributesCan't open windowDCan't open windowDCan't open fileckcpro.w sstate at E pktProtocol errorUnexpected packet typeSorry, you must 'set speed' firstfailed: proto ttopen localCan't open lineproto ttopen localCan't condition lineserver backgrdserver quietSHOULD NOT SEE THIS IF IN BACKGROUND!KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server doneNCommand package 5A(053), 21 Nov 92Command? %spushcmd: savbuf:&cmpushcmpush: no memory for cmp&cmpop&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zpcmnum 2nd chknum okOutput file?Wildcards not allowed - %s aux:?Write permission denied - %s cmifi gtwordcmifi atxbuf?malloc error 73, cmifi cmifi svcmifi sv wild?No files match - %s ?Too many files match - %s cmifi sv not wild?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s .*?No files match - %s ?Too many files match - %s cmifi partialcmifi partial k%scmifi partial cmdbufcmifi partial atmbuf%s Input file specification %scmifi ? *xp, cc.*cmifi ? wild?No files match - %s ?Too many files match - %s , one of the following: %s%scmdir gtword Directory name %s %s%scmfld: gtwordcmfld xcmfld: returns%s Please complete this field %s %s%scmtxt, cmflgscmtxt (*f)cmtxt: gtword xcmtxt calling (*f)cmtxt (*f) returns%s Text string %s %s%s?Unexpected return code from gtword() - %d cmkey: table length cmflgs zzcmkey: gtwordcmkey atxbuf after *f?Ambiguous - %s ?No keywords match - %s %s cmkey: defaultcmkey: esc?No keywords match - %s %s cmkey: addbuf No keywords match One of the following: %s, one of the following: %s or the token '%c' or one of the tokens '%s' %s%s %d - Unexpected return code from gtword cmcfm: cmflgscmcfm: atmbuf?Not confirmed - %s ?Not confirmed - %s Type a carriage return to confirm the command %s%s %s ungword cmflgsgtword ungetting from ppgtword returning atmbufgtword: cmdbuf bp ppgtword char %sgtword quote?Command too long, maximum length: %d.  chknumL RQ)K#_}SP}HY[23gV ( F i  ! !8!d!!""H"I"z"""""###d#~###$$3$Q${$$$%8%]%%%&&&]&&&&'3'y''((X(s(((() )5)?)M)V)b)i)q))*+z++,,N,,-(-u---..`.../0112;2}22223=3~344E445 55565}56 6U6]6^667@7788d889 99&9i99:E:::::;;;;<>J>>>??(?m??@$@l@@AA`AAABBZBBC%C&CBCCCDDhDvDwDEENEEEEF;FFFGGJGGHHhHHII\IIJJSJpJJJJK%KpKKL:L;LLMMGMHMpMMN N N(NtNNOO"O#OEOdOOP(PaPbPPPQ8QqQrQQR%RnRRS$SRS`SST2TwTTTUU-UCUDUiUUVV`VVVVVWW"W#WNWWXXX?XXXXYY%YmYYYYZ2ZDZEZZZ[1[v[[[[\;\\]]b]z]{]]^^N^^___,_w_```+`t````u.uTuuvvZvvwwWwwx xTxxxxy yEyFyayyzzz,zxzzz{*{p{{{||Y|||}C}g}}~ ~H~I~l~~i]EFj@Ag2rh23Vx9a]5z{[2|4I~&={ X3H K`6GH[&ndCj [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. = means ignore following words, but place in array \&@[]. actions: -s files send files -r receive files -s - send files from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l line communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 2400 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -d log debug info to debug.log -y name alternate init file name -w write over files -e n receive packet length -v n window size -z force foreground If no action command is included, or -S is, enter interactive dialog. Usage: Trustees of Columbia University in the City of New York. Type INTRO for an introduction to C-Kermit, press ? for a list of commands.Type HELP followed by a command name for help about a specific command.Type NEWS for news about new features.While typing commands, you may use the following special characters: DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. CTRL-W: Delete the most recent word typed. CTRL-U: Delete the current line. CTRL-R: Redisplay the current line. ? (question mark) Display a menu for the current command field. ESC (or TAB) Attempt to complete the current field. \ (backslash) include the following character literally or introduce a backslash code, variable, or function.Command words other than filenames can be abbreviated in most contexts.From system level, type "kermit -h" for help about command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,Digital Press. DP ISBN: 1-55558-108-0; Prentice-Hall ISBN: 0-13-037490-3.DECdirect: +1-800-344-4825, Order Number EY-J896E-DP, US $34.95.New features since "Using C-Kermit" was published: . Hebrew character-set translation; commands: SET { TRANSFER, TERMINAL, FILE } CHARACTER-SET - { HEBREW-ISO, HEBREW-7, CP862 } SHOW CHARACTER-SETS . A way to send control characters "bare" in Kermit packets; commands: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } SHOW CONTROL-PREFIXING . A way to change the Control and Repeat prefixes; commands: SET { SEND, RECEIVE } CONTROL-PREFIX SET REPEAT PREFIX SET REPEAT COUNTS { ON, OFF } . A way to change the packet-mode keyboard-breakout mechanism; commands: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] } SHOW PROTOCOL . A new string function, \freplace(s1,s2,s3). . A new command, SET OUTPUT PACING . . A new command, APC, for sending commands to MS-DOS Kermit. . Bug fixes, support for more systems. Type the appropriate HELP commands for more information,consult the CKCKER.UPD (C-Kermit Update) file for complete details.Welcome to C-Kermit communications software for: . Error-free file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . UNIX, VAX/VMS, OS/2, AOS/VS, OS-9, Commodore Amiga, Atari ST. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request help about a command TAKE execute commands from a file Commands for file transfer: SEND send files RECEIVE receive files SERVER be a file transfer server Essential settings: SET PARITY communications parity SET FLOW communications flow control, such as XON/XOFF SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: Kermit Distribution E-mail: Columbia University kermit@columbia.edu (Internet) 612 West 115th Street KERMIT@CUVMA (BITNET/EARN/CREN) New York, NY 10025 USA Phone: +1 212 854-3703 Fax: +1 212 662-6442Syntax: BYE Shut down and log out a remote Kermit serverSyntax: CLOSE nameExample: CLOSE SESSION Close one of the following logs or files: SESSION TRANSACTION PACKET DEBUGGING READ WRITEType HELP LOG and HELP OPEN for further info.Syntax: CONNECT (or C) Connect to a remote computer via the tty device given in the most recent SET LINE command, or the network host named in the most recent SET HOST command. Type the escape character followed by C to get back, or followed by ? for a list of CONNECT-mode escape commands.Syntax: GET filespec Tell the remote Kermit server to send the named file or files. If the filespec is omitted, then you are prompted for the remote and local filenames separately.Syntax: LOG (or L) name [ { NEW, APPEND } ]Record information in a log file: DEBUGGING Debugging information, to help track down bugs in the C-Kermit program (default log name is debug.log). PACKETS Kermit packets, to help with protocol problems (packet.log)SESSION Terminal session, during CONNECT command (session.log)TRANSACTIONS Names and statistics about files transferred (transact.log) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created.Syntax: RECEIVE (or R) [filespec] Wait for a file to arrive from the other Kermit, which must be given aSEND command. If the optional filespec is given, the (first) incomingfile will be stored under that name, otherwise it will be stored underthe name it arrives with.Syntax: SEND (or S) filespec [name] Send the file or files specified by filespec. filespec may contain wildcard characters '*' or '?'. If no wildcards, then 'name' may be used to specify the name 'filespec' is sent under; if 'name' is omitted, the file is sent under its own name.Syntax: MSEND filespec [ filespec [ ... ] ] Send the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. An alternate name cannot be given.Syntax: SERVER Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program. Use FINISH or BYE to get C-Kermit out of server mode.The SET command is used to establish various communication or fileparameters. The SHOW command can be used to display the values ofSET parameters. Help is available for each individual parameter;type HELP SET ? to see what's available.Syntax: SET KEY k text Map the key k to send 'text' when pressed during CONNECT mode.K can be expressed as decimal number or backslash code, 'text'can also contain any backslash code. If 'text' has the length 1it is treated specially. In some environments (OS/2, for example)that single character may be wider than 8 bits, if specified inbackslash notation. In this case, a scan code mapping takes place,i.e. key k takes over the function of the key whose scan code isassigned to k. This may even be a controlling key for the CONNECTmode. If 'text' is empty, the default key binding is restored forthe key k.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, orBLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3specify more rigorous checking at the cost of higher overhead. TheBLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain noblanks.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31, 127-159, 255.The word "ALL" means the command applies to all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL isrecommended for safety. You can include multiple values in onecommand, separated by spaces.Syntax: SET FLOW value Type of flow control to use during file transfer and CONNECT mode.Choices: KEEP (don't change device's current setting), XON/XOFF (softwareflow control, the default), NONE (no flow control at all), and possiblyothers including RTS/CTS (hardware) depending on the capabilities of yourcomputer and operating system. Type SET FLOW ? for a list.Syntax: SET FILE parameter valueParameters: TYPE: How file contents are to be treated during file transfer.TYPE is normally TEXT, with conversion of record format and character set.BINARY means to do no conversion. Use BINARY for executable programs orbinary data. Example: SET FILE TYPE BINARY. BYTESIZE { 7, 8 }: normally 8. If 7, truncate the 8th bit of all file bytes. INCOMPLETE - what to do with an incompletely received file: DISCARD(default), or KEEP. NAMES are normally CONVERTED to 'common form' during transmission; LITERALmeans use filenames literally (useful between like systems). COLLISION tells what to do when a file arrives that has the same name asan existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if it is newer than the existing file.Example: SET FILE COLLISION UPDATE SET FILE DISPLAY selects the format of the file transfer display forlocal-mode file transfer. The choices are: SERIAL (the default). One dot is printed for every K bytes transferred. This format works on any kind of terminal, even a hardcopy. CRT. Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. NONE. No file transfer display at all. WARNING. SET FILE WARNING is superseded by the newer command, SET FILECOLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAMEand SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. Syntax: SET HANDSHAKE value Character to use for half duplex line turnaround handshake during filetransfer. C-Kermit waits for this character from the other computer beforesending its next packet. Default is NONE, others are XON, LF, BELL, ESC,etc. SET HANDSHAKE CODE lets you specify the numeric ASCII value of thehandshake character. Type SET HANDSH ? for a list.SET SERVER DISPLAY {ON,OFF}Tell whether local-mode C-Kermit during server operation should put afile transfer display on the screen. Default is OFF. SET SERVER TIMEOUT nServer command wait timeout interval, how often the C-Kermit server issuesa NAK while waiting for a command packet. Specify 0 for no NAKs at all.Default is 0.The REMOTE command is used to send file management instructions to aremote Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.Syntax: IF [NOT] condition command If the condition is (is not) true, do the command. Only one command maybe given, and it must appear on the same line as the IF. Conditions are: SUCCESS - the previous command succeeded FAILURE - the previous command failed BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground DEFINED variablename or macroname - The named variable or macro is defined NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n1 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 > n1 n2 - n1 is arithmetically greater than n2 The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less See also XIF.Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Extended IF command. The conditions are the same as for IF (type HELP IF)but multiple comma-separated commands may be grouped within braces in boththe IF and ELSE parts. The ELSE part, if any, must be on the same line asthe XIF (or use dash for line continuation). Example: XIF equal \%a YES { echo OK, goto begin } ELSE { echo Not OK, stop }Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist thenumber of times given by the initial value, final value and increment.Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketedcommandlist while the condition is true. Conditions are the same as forIF commands.Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specifiedmode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or writeto a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename promptExample: ASKQ %p { Password:} Issues the prompt and defines the variable to be whatever you type in.The characters that you type do not echo on the screen.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: ASK variablename promptExample: ASK %n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally.No expansion or evaluation of the definition is done. Thus if thedefinition includes any variable or function references, their names areincluded, rather than their values (compare with ASSIGN). If the definitionis omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro).The definition string is fully evaluated before it is assigned, so thatthe values of any variables are contained are used, rather than theirnames. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This will print 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current valueis numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value isnumeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: PAUSE [ number ]Example: PAUSE 3 Do nothing for the specified number of seconds; if no number given, onesecond. If interrupted from the keyboard, set FAILURE, otherwise SUCCESS.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given,100 milliseconds.Syntax: ! [ command ] or RUN [ command ] or PUSH [ command ] Give a command to the local operating system's command processor, anddisplay the results on the screen. If the command is omitted, enter interactive mode; return to Kermitby exiting from the system's command parser. The command is usuallyEXIT or QUIT or LOGOUT.Syntax: TRANSMIT file The TRANSMIT command is used for sending single files to other computersthat don't have Kermit. Text files are sent a line at a time; binary filesare sent a character at a time. There is no guarantee that the othercomputer will receive the file correctly and completely. Before you startthe TRANSMIT command, you must put the other computer in data collectionmode, for example by starting a text editor. TRANSMIT may be interrupted byCtrl-C. Synonym: XMIT.Syntax: WAIT number [modem-signal(s)]Example: WAIT 5 \cd\cts Waits up to the given number of seconds for all of the specified signals.Sets FAILURE if signals do not appear in given time or if interrupted bytyping anything at the keyboard during the waiting period. Signals: \cd = Carrier Detect, \dsr = Dataset Ready, \cts = Clear To SendWarning: This command does not work yet, signals are ignored.Syntax: WRITE name text Writes the given text to the named log or file. The text text may includebackslash codes, and is not terminated by a newline unless you include theappropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGDOHELP xxSyntax: APC text Echoes the text in the form of a VT220/320/420 Application Program Command. Use the APC command to send commands to MS-DOS Kermit 3.13 or later.Describes how to report C-Kermit bugs.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: CLEAR [ { DEVICE, INPUT, BOTH } ] Clears the communications device input buffer, the INPUT command buffer, or both. The default is BOTH.Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: CD [ directoryname ] Change Working Directory, equivalent to UNIX cd command.Syntax: DECLARE arrayname[size] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables.Syntax: DELETE filespec Delete a local file or files. RM is a synonym for DELETE.Syntax: DIRECTORY [ filespec ] Display a directory listing of local files.Syntax: DISABLE command Security for the C-Kermit server. Prevent the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Execute a macro that was defined by the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1, \%2, etc.Syntax: ECHO text Display the text on the screen, followed by a newline. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: ENABLE capability For use with server mode. Allow the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exit from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: ERROR Send an Error packet to the other Kermit to get it out of packet mode.Syntax: QUIT (or EXIT) Exit from the Kermit program, closing all open files and devices.Syntax: FINISH Tell the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Print the prompt, make user type 'yes', 'no', or 'ok', and set SUCCESS or FAILURE accordingly.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection.%s, Copyright (C) 1985, 1993,Give a brief introduction to C-Kermit.Syntax: INPUT n [ text ] Example: INPUT 5 Login: Wait up to n seconds for the given text to arrive on the communication line. If no text, waits for any character. For use in script programs with IF FAILURE and IF SUCCESS. Also see SET INPUT.Syntax: REINPUT n string Look for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Change the name of file 'oldname' to 'newname'.Introduce a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Send the file to the remote Kermit, which must be in RECEIVE or SERVER mode, and request that the remote host deliver the file as electronic mail to the given address. Example: MAIL BUG.TXT KERMIT@CUVMA Print news of new features since publication of "Using C-Kermit".Syntax: OUTPUT text Send the text out the currently selected line, as if you had typed it during CONNECT mode. The text may contain backslash codes. Example: OUTPUT help\13Syntax: PRINT file [ options ] Print the local file on a local printer with the given options.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Read a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with with \fexecute(macro), which allows macros to be used like functions.Syntax: SUSPEND or Z Suspend Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET yDisplay current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TYPE file Display a file on the screen. Pauses if you type Ctrl-S, resumes if you type Ctrl-Q, returns immediately to C-Kermit prompt if you type Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.Help not available - %s %s %s Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command, used for uploading filesto computers that don't have Kermit programs. Parameters are: ECHO ON/OFF: Whether to echo text as it is being transmitted.EOF text: Text to send after end of file is reached.FILL number: ASCII value of character to insert into blank lines.LINEFEED ON/OFF: Transmit LF as well as CR at the end of each line. Normally, only CR is sent.LOCKING-SHIFT ON/OFF: Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.PAUSE number: How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).PROMPT number: ASCII value of character to look for from host before sending next line, normally LF (10).Synonym: SET XMIT.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screeneven though Kermit thinks it is running in the background.Syntax: SET BUFFERS n1 n2 Change the overall amount of memory allocated for SEND and RECEIVE packetbuffers, respectively. Bigger numbers let you have longer packets and morewindow slotsSyntax: SET COMMAND BYTESIZE { 7, 8 } SET COMMAND BYTE 8 allows you to use an 8-bit (international) character setin the commands you type at the C-Kermit> prompt. 7 is the default.Syntax: SET CARRIER ON, AUTO, or OFF Attempts to control treatment of carrier on the communication device.ON means that carrier is required at all times except during the DIALcommand. OFF means that carrier is never required. AUTO (the default)means that carrier is required only during CONNECT.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission ofselected file attributes along with each file, and to handle or ignoreselected incoming file attributes, including: DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET INPUT parameter value The SET INPUT command controls the behavior of the INPUT command: SET INPUT CASE { IGNORE, OBSERVE }Tells whether alphabetic case is to be significant in string comparisons.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files. SET INPUT ECHO { ON, OFF }Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUTcommand times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT }Tells whether to proceed or quit from a script program if an INPUT commandfails. PROCEED (default) allows use of IF SUCCESS and IF FAILURE commands.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files.Syntax: SET TAKE parameter value Controls behavior of TAKE command. SET TAKE ECHO { ON, OFF } tells whether commands read from a TAKE fileshould be displayed on the screen. SET TAKE ERROR { ON, OFF } tells whether a TAKE command file should beautomatically terminated when a command fails. This setting is local tothe current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter value SET TERMINAL BYTESIZE 7 or 8, to use 7- or 8-bit terminal charactersbetween C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } to specify how incomingcarriage return characters are to be displayed on your screen. SET TERMINAL ECHO { LOCAL, REMOTE } to specify which side does theechoing during terminal connection. SET TERMINAL LOCKING-SHIFT { OFF, ON } tells C-Kermit whether to useShift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bitcharacters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } tells whether to send CRLF when youtype CR during CONNECT mode. Type SHOW TERMINAL to see current terminal settings.Syntax: SET MACRO parameter value Controls the behavior of macros. SET MACRO ECHO { ON, OFF } tells whether commands executed from a macrodefinition should be displayed on the screen. SET MACRO ERROR { ON, OFF } tells whether a macro should be automaticallyterminated upon a command error. This setting is local to the currentmacro, and inherited by subordinate macros.Syntax: SET PROMPT [ text ] Prompt text for this program, normally 'C-Kermit>'. May contain backslashcodes for special effects. Surround by { } to preserve leading or trailingspaces. If text omitted, prompt reverts to C-Kermit>. Prompt can includevariables like \v(dir) or \v(time) to show current directory or time.Syntax: SET WINDOW-SIZE number Specify number of window slots for sliding windows, the number of packetsthat can be transmitted before pausing for acknowledgement. The defaultis one, the maximum is 31. Increased window size may result in reducedmaximum packet length. Use sliding windows for improved efficiency onconnections with long delays. A full duplex connection is required.Syntax: SET REPEAT { COUNTS { ON, OFF }, PREFIX } SET REPEAT COUNTS turns the repeat-count compression mechanism ON and OFF. The default is ON.SET REPEAT PREFIX sets the repeat-count prefix character to the given code. The default is 126 (tilde).Syntax: SET RECEIVE parameter value Specify parameters for inbound packets: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit receives, normally 35 (number sign). Don't change this unless something is wrong with the other Kermit program.END-OF-PACKET number ASCII value of control character that terminates incoming packets, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet the other Kermit should send.PADDING number Number of prepacket padding characters to ask for (normally 0).PAD-CHARACTER number ASCII value of control character to use for padding (normally 0).START-OF-PACKET number ASCII value of character that marks start of inbound packet.TIMEOUT number Number of seconds other Kermit should wait for a packet before sending NAK or retransmitting.Syntax: SET SEND parameter value Specify parameters for outbound packets. This command should be used onlyto override the normal negotiated parameters and is rarely needed: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit sends, normally 35 (number sign).END-OF-PACKET number ASCII value of control character to terminate an outbound packet, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet to send, even if other Kermit asks for longer ones.PADDING number Number of prepacket padding characters to send.PAD-CHARACTER number ASCII value of control character to use for padding.START-OF-PACKET number ASCII value of character to mark start of outbound packet.TIMEOUT number Number of seconds to wait for a packet before sending NAK or retransmitting.Synonym: SET XFER Syntax: SET TRANSFER LOCKING-SHIFT { OFF, ON, FORCED } Tell whether locking-shift protocol should be used during file transferto achieve 8-bit transparency on a 7-bit connection. ON means to requestits use if PARITY is not NONE and to use it if the other Kermit agrees,OFF means not to use it, FORCED means to use it even if the other Kermitdoes not agree.Syntax: SET CASE { ON, OFF } Tells whether alphabetic case is significant in string comparisons done by INPUT, IF, and other commands. This setting is local to the current macro or command file, and inherited by subordinates.Syntax: SET INCOMPLETE { DISCARD, KEEP } Discard or Keep incompletely received files, default is DISCARD.Syntax: SET COUNT number Example: SET COUNT 5 Set up a loop counter, for use with IF COUNT. Local to current macro or command file, inherited by subordinate macros and command files.Syntax: SET DEBUG { SESSION, ON, OFF } SESSION means display control and 8-bit characters symbolically during CONNECT mode. ON means log debugging information to file debug.log.Syntax: SET DEFAULT directory Change directory. Equivalent to CD command.Syntax: SET DELAY number Number of seconds to wait before sending first packet after SEND command.Syntax: SET DUPLEX { FULL, HALF } During CONNECT: FULL means remote host echoes, HALF means C-Kermit does its own echoing.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt.Syntax: SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character. Syntax: SET LINE devicename or: SET PORT devicename Select communication device to use. Normally %s. If you SET LINE to other than %s, then Kermit will be in 'local' mode; SET LINE alone will reset Kermit to remote mode. To use the modem to dial out, first SET MODEM-DIALER (e.g., to HAYES), then SET LINE xxx, next issue the DIAL command, and finally CONNECT. Syntax: SET PARITY name Parity to use during terminal connection and file transfer: EVEN, ODD, MARK, SPACE, or NONE. Normally NONE.Syntax: SET QUIET {ON, OFF} Normally OFF. ON disables most information messages during interactive operation.Syntax: SET RETRY number How many times to retransmit a particular packet before giving up.Syntax: SET SPEED number Communication line speed for external tty line specified in most recent SET LINE command, in bits per second. Type SET SPEED ? for a list of possible speeds.Not available yet - %s Syntax: REMOTE SET parameter valueExample: REMOTE SET FILE TYPE BINARY Ask the remote Kermit server to set the named parameter to the given value.Equivalent to typing the corresponding SET command directly to the otherKermit if it were in interactive mode.Syntax: REMOTE CD [ name ] Ask remote Kermit server to change its working directory or device. If the device or directory name is omitted, restore the default.Syntax: REMOTE DELETE filespec Ask the remote Kermit server to delete the named file(s).Syntax: REMOTE DIRECTORY [ filespec ] Ask the remote Kermit server to provide a directory listing of the named file(s) or if no file specification is given, of all files in the current directory.Syntax: REMOTE HELP Ask the remote Kermit server to list the services it provides.Syntax: REMOTE HOST command Send a command to the remote host computer in its own command language through the remote Kermit server.Syntax: REMOTE KERMIT command Send a command to the remote Kermit server in its own command language.Syntax: REMOTE LOGIN user password [ account ] Log in to a remote Kermit server that requires you login.Syntax: REMOTE LOGOUT Log out from a remote Kermit server to which you have previously logged in.Syntax: REMOTE PRINT filespec [ options ] Send the specified file(s) to the remote Kermit and ask it to have the file printed on the remote system's printer, using any specified options.Syntax: REMOTE SPACE [ name ] Ask the remote Kermit server to tell you about its disk space on the current disk or directory, or in the one that you name.Syntax: REMOTE TYPE file Ask the remote Kermit server to type the named file(s) on your screen.Syntax: REMOTE WHO [ name ] Ask the remote Kermit server to list who's logged in, or to give information about the named user.not working yet - %s "%-/ 3x8<BFKOhTZ_b<finsx     emos &.38>BEJPYaiw~ )6prefixedunprefixedpacing123blank-free-2countsprefixchanges-speedmatches-speedautooffonoffonsession01101200150192002002400300360038400480050600759600fullhalfbytesizecollisiondisplayincompletenamestypewarningkeepnonexon/xoffbellcodecresclfnonexoffxonbinarytextevenmarknoneoddspaceoffonlocaloffonremotediscardkeepechoerroroffonechoerrorbytesizedisplaytimeoutlocking-shiftforcedoffoncharacter-setscyrillicdebugdialdynamic-memoryfullscreen-displayhebrewhelpif-commandjob-controlkanjilatin1latin2networkpushscript-commandserver-modeshow-commandtransmit %svailable Not aA CHECK: feature not available numeric key code?key code must be between 0 and %d key definition...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. discard31010send buffer size?two numbers required ?too smallreceive buffer size?receive buffer size required ?too small1%d400autoCarrier wait timeout, seconds0Positive number0?A positive number, please XYCOUN: zbytesizebytesize for command characters, 7 or 87 ?The choices are 7 and 8 debug.logNumber of seconds before starting to send5full%dDecimal ASCII code for CONNECT-mode escape characterxon/xoffset flownoneASCII value?Character must be in ASCII control range noneProgram's command promptC-Kermit>Maximum retries per packet10?Retry limit must be greater than window size %d403%dinterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs %d404 ?Speed cannot be set for network connections Transmission rate for %s in bits per second?value required ?Sorry, you must SET LINE first ?Unsupported line speed - %ld %s, 75/1200 bps %s, %ld bps character-setonNumber of sliding-window slots, 1 to 311%d406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterpacingMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listSET CONTROL atmbufallala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. repeat-count compression parameter(not implemented yet, nothing happens) ASCII value?Illegal value for prefix character Not working yet - %s control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d @DHLPTX\`dhlptx|  !"  #) 2: AGN U\a!isx     JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSatargcargscmdfilecmdlevelcmdsourcecountcpudatedaydirectoryexitstatusfilespecfsizehomehostinputincharincountlinelocalmacrondatendayntimeplatformprogramreturnspeedstatussystemtfsizetimeversioncharactercodecontentsdefinitionevaluateexecutefilesindexlengthliterallowerlpadmaximumminimimnextfilereprepeatreplacereverserightrpadsubstringupperappendnewCKERMIT.INImissing name in -ydebug.log?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... transmit char?Can't transmit character transmit bufCan't send buffer Name of debugging log filedebug.logName of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.log ?Unknown log designator - %d DispositionnewTransaction Log:Debug Log Communications Parameters: Host: %s Line: %s, speed: unknown75/1200%ld, mode: localremote, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Named Pipe, telnet protocol Terminal bits: %d, p Parity: %s, duplex: half, full, flow: keepxon/xoffnonedtr/ctsrts/ctsdtr/cd%d, handshake: %d none offonautounknown Carrier: %s, timeout: %d sec, timeout: none Escape character: %d (^%c) No networks are supported in this version of C-Kermit File parameters: Attributes: onoff Names: %-12sconvertedliteral Debugging Log: %snone Type: textbinary?%-12s Packet Log: none Collide: %-12sunknown Session Log: none Display: %-12snone%-12sserial%-12sfullscreen%-12scrt Transaction Log: none File Byte Size: %d, Incomplete Files: keepdiscard, Init file: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Server Timeout:%4d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' Packet Length:%11d %8d Repeat Prefix: '%c' Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced %senableddisabled,%s%s not used %s,%s Most recent transaction -- files: %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) 8th bit prefixing : yes [%c] no locking shifts : %s yesno window slots used : %d of %d packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %d sec transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps efficiency (percent) : %d ?Can't condition line for INPUT doinput?malloc error 5 input ttinc(1) returnsinput interrupted from keyboardinput coninc(1) returnsdoinput charcompare chardoreinput?malloc error 6 doreinp charcompare charfnevalfnevalfneval function argfneval malloc failure, argfneval xxstring fails, argfneval argfneval arg post evalfneval evaluated argfexec pushed too deep ?\fexec() too deeply nested %d00%d0%d%d%d%d%d%dunknownAtari_ST%ld%ld%dunknown%ld%dC-Kermit%ld%ldunknown%d%d10promptmacrofileunknown%d?definition is circular or too deep xxstringxxstring r2xxstring function namexxstring r2 before freexxstring function argxxstring freeing r2xxstring vnamePʼnŮ;ƀƁƥ%&WǂǃQset parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1_assign _for\v(cmdlevel) { _getargs,define \\\%1 \%2,:top,if \%5 \\\%1 \%3 goto bot,\%6,:inc,incr \\\%1 \%4,goto top,:bot,_putargs},def break goto bot, def continue goto inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:inc,\%1,\%2,goto inc,:bot,_putargs},_def break goto bot, _def continue goto inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)cmdini: no memory for keymapcmdini: no memory for macrotabCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for linecmdini: no memory for tmpbufCan't allocate macro buffers!C-Kermit>ibm-linemodefatal_forx_xif_while\&@[%d]\&@[%d]ini file isropen okinit filergetncmcharnext cmdgetncm eom%s getncm returns ptr togetnctgetnct malloc failure%sLine from TAKE filegetnct nlgetnct bad lineWarning: Last line of TAKE file lacks terminator getnct igetnct lp2?Command too long, maximum length: %d. Trailing commentComment trimmed & terminatedLast char in lineLine is continued&parser entry maclvl&parser entry inlevel&parser entry tlevel&parser entry cmdlvl&parser entry mtop of parse looptlevelcmdlvlCommand file terminated by error. Command error: macro terminated. parser macroparser maclvlcmdbuf from macro?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersparser top of while loopCommandtop-level cmkey2top-level cmkey token ?Invalid - %s docmd returns?Invalid: %s top-level cmkey failedKermit command error in background executionparser preparing to continueparser breaks out of while loopxxout nxxout pacingxxout stringOUTPUT BREAKOUTPUT Long BREAKOUTPUT error herald%s,%s Type ? or HELP for help addmmac lineaddmmac linesaddmmac loop exitaddmmac length?addmmac malloc error: %s addmmac malloc erroraddmmac constructed stringaddmmac length mismatch !addmmac internal error! addmac namaddmac def(null pointer)addmac def?addmac malloc error 2 addmac paddmac p(null pointer)addmac numeric global maclvladdmac macro arg maclvladdmac globaladdmac macro error 7: %s addmac macro defaddmac table sizeaddmac table overflowaddmac position?addmac malloc error 3: %s ?addmac malloc error 5: %s delmac namdelmac defdelmac def(null pointer)delman defdelmac def(null pointer)delmac mlookpopclvl beforepopclvl after ?Debugging log wasn't open ?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open ?Unexpected log designator - %d disabledenabled Versions: %s Numeric: %ld-%d %s for%s %s %s for%s %s %s %s %s %s %s Special features: Control-character unprefixing Features not included: No fullscreen file transfer display No network support No DIAL command No SCRIPT command No character-set translation No automatic parity detection None Compiled %s %s, options: Jul 1 099300:50:18 DEBUG TLOG CK_SPEED NODIAL DYNAMIC CMDDEP=%d __STDC__ Press key: ?Error reading key Key code \%d => String: \{%d} Character: \%u%c \%u (self, no translation) Macro name, or carriage return to see them all%s - not found Macros: %d Function Status: GET %s SEND %s REMOTE CD/CWD %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s Server timeout: %d Server display: %s onoff %s SUCCESSFAILURE Command bytesize: %d bits Terminal bytesize: %d bits Terminal echo: %s localremote Terminal locking-shift: %s onoff Terminal newline-mode: %s onoff Terminal cr-display: %s crlfnormal CONNECT-mode escape character: %d (Ctrl-%c, %s) DEL \v(%s) = %s \f%s() Global variables: \%%%c No variables defined Macro arguments at level %d \%%%d = %s No macro arguments at top level Declared arrays: \&%c[%d] No arrays declared Take Echo: %s OnOff Take Error: %s OnOff Macro Echo: %s OnOff Macro Error: %s OnOff Input Case: %s ObserveIgnore Input Echo: %s OnOff Input Silence: %d (seconds) Input Timeout: %s QuitProceed Output Pacing: %d (milliseconds) File type: %s binarytext Terminal echo: %s localremote Transmit EOF: none ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: none Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: none Transmit Echo: %s onoff Transmit Locking-Shift: %s onoff Transmit Pause: %d milliseconds Escape character: Ctrl-%c (ASCII %d, %s) DEL Character set translation is not supported in this version of C-Kermit Nothing to show... Line: %s, Modem: Communication device not yet selected with SET LINE Modem: (disabled) %s = (null definition)Attributes: %s OnOff Blocksize: %s OnOff Date: %s OnOff Disposition: %s OnOff Encoding (Character Set): %s OnOff Length: %s OnOff Type (text/binary): %s OnOff System ID: %s OnOff System Info: %s OnOffinvalid digit '%c' in number Invalid character '%c' in input +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript must be numeric - %s ?Array dimension or subscript must be positive or zero - %s ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range %dxwords macrododo maclvldodo maclvl too deepMacros nested too deeply do macrododo cmdlvl too deep?TAKE files and DO commands nested too deeply do macro%0\flit(Name of local directory, or carriage return?Wildcards not allowed in directory name %s%sߊߍߑߕߘߞߥ߬߱߷ ߹߻ ߽  cdctsdsrri!read!writeappendreadwrite<=>backgroundcountdefinedequalerrorexistfailureforegroundlltlgtnotnumericsuccessVariable name?Variable name required ?Read file not open read zsinlread addmacPrompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).{ Yes or no? }Please respond Yes or No Please respond. Type \? to include a question mark in your response. cmtxt ask addmacVariable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required dodef successdodefDefinition of variablexxdef var namexxdef var def?Argument vector array is read-only Definition of array elementxxdef array refxxdef array defDefinition of macroxxdef macro namexxdef macro defcalling addmac?%s failed ASSIGNDEFINEDirectory/file specificationCK_DIR%s %sFile(s) to delete?A file specification is required xxdel tmpbuf%s %sxxdel line%s - %sdeleted not ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _forx initial valuefinal valueincrement1%d Command to execute?Unbalanced brackets ?Zero increment not allowed _forx_forx_forx?FOR macro definition gone! FOR command?Incomplete FOR command %s,%s Numeric: %ld-%d To report C-Kermit bugs, send e-mail to: kermit@columbia.edu (Internet) KERMIT@CUVMA (EARN/CREN/BITNET) ...!uunet!columbia.edu!kermit (Usenet) Or write to: Kermit Development Columbia University 612 W 115 Street New York, NY 10025 USA Or call: +1 212 854-5126 (USA) Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. seconds to wait1seconds to pause1milliseconds to sleep100modem signalFile to rename?Name of existing file required ?Please specify a single file New name?New name for file required ?Can't return from level %d RETURN parseRETURN copy&return&returnNULLmode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file ?Read file already open System command to read from?Command name required ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Write/Append file already open ?Not implementedCommand file ends prematurely in multiline GET OofaRemote filename missing in multiline GET MupeenMacro definition ends prematurely in multiline GET OofaRemote filename missing in multiline GET Mupeen Remote file specification: Name of remote file(s) cmtxt(cancelled) Local name to store it under: Local file name(cancelled) xxget cmargxxget fspec_getargs maclvl_putargs maclvlsuccess_getarg p(null pointer)_getarg p_putarg m_arg[maclvl+2][i]_putarg m_arg[maclvl+2][i](null pointer)_get/putarg exit_get/putarg exit maclvlgoto cmdlvlgoto maclvlgoto tlevelgoto before conversiongoto after conversion?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro goto in macromacro GOTO labelmacro target labelgoto failed at cmdlvl?Label '%s' not found goto found macro labelgoto failed at cmdlvl?Label '%s' not found ?Stack problem in GOTO %s ?Condition required if successif failureMacro or variable nameIF DEFif definedif countFile?Filename required if existfirst word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long IF comparisonfirst number or variable name?Quantity required xxifgt cmfldxxifgt exp1countversionargcsecond number or variable name?Quantity required xxifgt exp2countversionargcxxifft ifcxxifft n1xxifft n2xxifft zvariable name or constant?Quantity required xxifnu cmfldxxifnu quantityxxifnu chknumdoif: pushing command command to be ignoredObject commandelse_xif_xif_xif?XIF macro gone! { \flit(if not goto bot) } WHILE cmdObject commandWHILE body_while_while_while?WHILE macro definition gone! WHILE dodo?Can't allocate storage for WHILE commandrFailure to open?TAKE files and/or DO commands nested too deeply  %).7EKRY`hu  "(/=ETbp~"  #%$   & +0@EM\dipechoeoffilllinefeedlocking-shiftpausepromptappendbackupdiscardno-supersedeoverwriterenameupdatecollisionnamesrecord-lengthtypeconvertedliteralbytesizecr-displayecholocking-shiftnewline-modecrlfnormalfixedundefinedcrtnoneoffonquietserialpacket-lengthtimeoutcontrol-prefixend-of-packetpacket-lengthpad-characterpaddingquotestart-of-packettimeoutattributesblock-checkfileincompletereceiveretryservertransferwindowalldatedispositionencodinglengthoffonsystem-idtypecasedefault-timeoutechosilencetimeout-actionproceedquitignoreobserveonsetnum ?Value required %s?Not a number: %s ?Sorry, %d is the maximum ?Value required ?Not in ASCII control range - %d Remote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 file transfer display stylehow to handle filenamesconverted%d301%dfile record length%d312type of filetext30010Filename collision actionbackup%d302?unexpected file parameter bytesize for terminal connection8 ?The choices are 7 and 8 which side echos during CONNECTremotenormalParameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character Decimal ASCII code for packet terminator13Sorry, the legal values are 0-31 Maximum number of characters in a packet90Sorry, 10 is the minimum %d401 Adjusting receive packet-length to %d for %d window slots Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Extended-length packets requested. Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start character1How many padding characters for inbound packets0Decimal ASCII code for packet padding character0%dPacket timeout interval%d402Packet timeout intervalCharacters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill character0Numeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmission0 Press the X or E key to cancel. ?Parameter name required Remote directory nameXZCWD: passwordName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specificationCommand for remote system?Remote host command required Command for remote Kermit?Remote Kermit command required User IDInternal error: malloc PasswordInternal error: malloc Account or carriage returnInternal error: malloc ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage return?Not implemented - %s ?File specification required rfilopFile Attribute packetsSorry, command not available 132101421014110135101331013910134101451014710?Not available Positive numberSeconds of inactivity before INPUT fails?Network connections not supported Communication device name?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Sorry, access to lock denied: %s Sorry, access to device denied: %s Sorry, device is in use: %s Sorry, can't open connection: %sSorry, can't open connection: %s Sorry, can't open connection: %s set line   #&),08<EIMQUY\`dgjmNULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1/XONDC2DC3/XOFFDC4NAKSYNETBCANEMSUBESCFSGSRSUSevenoddmarkspacenoneinvalidModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s OnOff Clear To Send (CTS): %s OnOff Ring Indicator (RI): %s OnOff Data Terminal Ready (DTR): %s OnOff Request to Send (RTS): %s OnOffspar: data spsiz timint npad padch seol ctlq ebq ebqflg bctr rptq rptflg lscapu atcapu lpcapu swcapu wslotnrpar: data rpsiz rtimo mypadn mypadc eol ctlq sq ebq ebqflg bctr rptq rptflg capas bits lscapu atcapu lpcapu swcapu wslotr rpsiz(extended)fatalFatal:setgenfnparse malloc errorfnparsefnparse rHOSTmore? Y or space-bar for yes, N for no ^C trap() caught signal^C...^C... ^C... stptrap() caught signal suspend disabled %sJob control not supported stptrap back from suspendstptrap W_CONNECTstptrap W_COMMAND pflag%sstptrap defaultconchkStatus report: file type: binarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length packet length window slotsCancelling Batch Cancelling File Resending packet X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: binarytext File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld [OK] [discarded] [interrupted] [skipped]Error: Refused: [incomplete]*** screen() called with bad status ***%s: %ld*** screen() called with bad object ***Protocol Error:Debug Log ClosedTransaction Log Closedon_exitdoexit exitstatdoexit what(NULL)(NULL)DEBUG string too long %s%s:%c %s%s:^%c %s%s:~^%c %s%s:~%c %s%s:%ld =%ld DEBUG string too long [%s] DEBUG string too long [%s]=%ld DEBUG string too long %s=%ld DEBUG string too long %s[%s] DEBUG string too long %s[%s]=%ld ?Invalid format for debug() - %d ?T-Log string too long %s %ld %s %ld ?T-Log string too long [%s] ?T-Log string too long [%s] %ld ?T-Log string too long %s: %ld ?T-Log string too long %s %s ?T-Log string too long %s %s: %ld ?Invalid format for tlog() - %ld xargvaction-l and -b required-a without -s, -r, or -gunredirected -k can only be used in local modeNo commands given for -Cconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -s-No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedconflicting actionsinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missingaux:can't open devicecmdlin speedinvalid argument bundlingmissing baudunsupported transmission rateinvalid argument bundling after -emissing lengthUnsupported packet lengthinvalid argument bundlingmissing or bad window sizeUnsupported packet lengthinvalid argument bundlingmissing parityinvalid parityinvalid argument, type 'kermit -h' for help~ *._7567Q&\*GG; % -20O9 ><C@J0N Q V*^ ` gHjHnr t w {V/+-9[ ]PP]P^D0 3 %'E,48<CJ&QCX[_afmq v|!!!"1N$4%&?>I'AJ%NXYTUu!#;:@  "3 3#3.3?2G.O7T6\n'tvy4      *@+D ? ".3#:@<H(M!V%_/h$t/1y|  ".9 IN\iu %*4<@GU]hq y         User Interface 5A(103), 26 Jun 93!#:@apcasgaskaskqassignbugbyeccatcdcheckclearclosecommentconnectcwddcldeclaredecrementdefinedeletedirectorydisabledoe-packetechoelseenableendexexitextprocffinishfoforfotggegetgetokgotohanguphelpiifinincrementinputintroductionlloglsmailmanmgetmpausemsmsendmsleepmputmvnewsoopenoutputpausepopprintpupushputpwdquitrreadreceivereinputremoterenamereplayreturnrmrunssendserversetshowsleepspspaspacespawnstatisticsstopsuspendtaketesttransmittypeversionwaitwhilewhowritexifxmitz_assign_define_getargs_putargsnookyesattributesbbabackgroundbaudblock-checkbufferscarriercasecommandcontrol-charactercountddedebugdefaultdelayduplexescape-characterfileflow-controlhandshakeincompleteiininputkeyllinelocal-echomacrooutputparityportpromptquietreceiverepeatretry-limitsendserverspeedsuspendtaketerminaltransfertransmitwindow-sizexmitcdcwddeletedirectoryhelphostkermitloginlogoutprintsetspacetypewhodebuggingpacketssessiontransactionsappend-filedebug-logerrorfilepacket-logscreensession-logsys$outputtransaction-logbothdevice-bufferinput-bufferappend-filedebug-logpacket-logread-filesession-logtransaction-logwrite-fileargumentsarraysattributescharacter-setscommunicationscontrol-prefixingcountdefaultescapefeaturesfilefunctionsglobalskeymacrosmodem-signalsnetworkparametersprotocolscriptsserverstatusterminaltransmitvariablesversionsxmitallbyecdcwddeletedirectoryfinishgethostsendsetspacetypewhodocmd entry, cx docmd XXGTAdocmd cxdocmd XXGTA maclvldocmd dogta returnsdocmd dogta maclvlbuffer(s) to clearbothText of comment lineWhich log or file to close?You must say which file or log Array name?Array name required ?Declare failed Server function to enableServer function to disable?Name of server function required optional return valueoptional return value ?No macros defined macro?Macro name required optional argumentsText to be echoedApplication Program Command text%c_%s%c\%s Text to be outputOUTPUT 1OUTPUT 2OUTPUT 3OUTPUT sizeOUTPUT 4File to print?A file specification is required ?Wildcards not allowed Local print command options, or carriage returnexit status codeName of remote file(s), or carriage returnC-Kermit commandhelpHELP command xtop-level cmkey token ?Invalid - %s label?Label name required %dseconds to wait for inputMaterial to be inputcalling doinputxxrei line?Input timed out ?Reinput failed label?Label name required What to log?Type of log required Name under which to store the file, or CRcmofi cmarg2Remote Kermit server command?You must specify a command for the remote server File(s) to send?A file specification is required Send: wildName to send it withSending: as:?Disposition Attribute is Off Mail: wildAddress to mail to?Address required ?Option string too long Mailing:To:Names of files to send, separated by spaces?A file specification is required msfiles Parameter?You must specify a parameter to set ?More fields required System command to executeparametersexit status code0Message to print%s ?Take files nested too deeply C-Kermit command file?A file name is required ?Wildcards not allowed in command file name File to transmit?Name of an existing file ?Only a single file may be transmitted calling transmitFile to type?Name of an existing file ?A single file please CK_TYPE%s %scmdlvl = %d, tlevel = %d, maclvl = %d %s Call me from inside a macro and I'll dump the argument stackMacro level: %d, ARGC = %d %7d %2d: %7s(none) %s,%s Numeric: %ld-%d user nameCK_WHO%s %sto file or log?Write to what? text%s%s ?File or log not open docmd unk arg(P<8D7<8D8DD8**++*+J+[+x++++, ,/,f,CONNECT Command for Atari ST, 5A(031) 5 Nov 91Sorry, you must SET LINE first Sorry, you must SET SPEED first ckucon openingSorry, can't open %sckucon open failureConnecting to %s, speed %ld. The escape character is %s (ASCII %d). Type the escape character followed by C to get back, or followed by ? to see other options. (Session logged to %s, %s) binarytextDebugging Display...) Sorry, can't condition console terminal connect cmaskconnect cmdmskSorry, Can't condition communication line connect ttvt ok, escapeSorry, CONNECT input buffer can't be allocated connect got escape[Back at Local System] C to return to the C-Kermit prompt, or: 0 (zero) to send a null B to send a BREAK Q to hangup and quit Kermit S for status ! to push to local shell \ backslash escape: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. ? for help escape character twice to send the escape character space-bar to resume the CONNECT command Press C to return to the C-Kermit prompt, or:Command> Hanging up Connected thru , speed %ld, %d terminal bits, evenoddspacemark parity, logging to Error resuming CONNECT session ERROR WRITING SESSION LOG, LOG CLOSED!-Dial Command Disabled-Script Command Disabled-Network support, 5A(019) 8 Jun 93GMT1.1.4:-1.1.10:2:60...... TIMEZONE@@@@@@@@@PPPPP@@@@@@@@@@@@@@@@@@    @Bad pointer in free. Bad error number: unassigned error number0d0m000000000001 11(171M/:/:/:/:/:/:/:/:/:/:/:/:1_1n1~11111/:11/:/:/:/:/:2/:2*2</:/:/:/:/:/:/:/:/:/:/:/:/:/:2J2V2e2Dno errorfundamental errordrive not readyunknown commandcrc errorbad requestseek errorunknown mediasector not foundno paperwrite faultread faultgeneral errorwrite protectmedia changeunknown devicebad sectors on formatinsert other diskfunction rangefunction domaininvalid function numberfile not foundpath not foundno handles leftaccess deniedinvalid handleinsufficient memoryinvalid memory block addressinvalid drive specifiedcross disk renameno more filesrange errorinternal errorinvalid program load formatsetblock failure due to growth restrictions22No shell msh.prg-cSHELLmsh.prgPATH,\bin,\usr\binTMPDIR\tmptXXXXXX{NULL} You must compile with the -f option to include printf() floating point! ^!^!^#3b3|3ARGV=4CCAP????????????????????????AAA AAA DD DD:DD:DD DDDD SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDeca 0Zh;L"20          &          \                       $&*V 8 6 4 4t&  T    :& @  $ ""      8 B >.   $          (                  * H2Z      (0          &     " 4 . "&  (  &     *   R@                   6 ," . &D  :$  8 P   d $ ( $ (" $ <  V| 0N$40 4, 4    &        *  F  . `  H         6     2 0                   (   ( "                                                                     0                                          &                        "    B         B* (           &  L *    2                      (        8      &:    H           "*   2            "      *                         *                                 *             ,         H "    *     8V&&PdL.6* 0F2.               &                                    $ &         $                  , $     B      4 $                       (   , *            $   & "&                $      "                      , ,         *. $   Vd,$      $6p.6   (,$ (n 62"   *                           "               $                      $                                                                                                                                                    *       (                                                                     B   $     "  (   B *   2      " 0  *  06         & 0       " *        $                 "  6               *        "\,     (( $   8          $        \ , $        "2      \ "  t, n(B$4V, (        8T&      & *    0(                      "   $      "        *          0&        4 $   ,    *   *  "  0  $( J$4* > "  6  ,            $   (*     &                                                                      *  ,$           r    ,$  r*       . *&8,  ,0R .6N :" . "   :< p      8 <8&(  , :B  r :  < <Z: :  |:\ 8 `: dlN"      ,0  &."           &"&     *" Z>  V   . L  "   HH$                  "                                2    X      "     * ( ,f . 2 L ^ &(                                   &             x( .( $@$* $( & 4  B$4@$8&<&     >   $   :,    $ ("*    "    8&  &  &":      $(*$            "               "  D   F                                 "         ,        J L   ,     N      8   l$     .         H< N.4X2 PFT$$< B , 2 T  J "                     t*     * L                                        B                                                                                                                                       H           b 0     &       . (        $8L   "     "       *                             H  (  &                            , . &, $                                                                                                              &                                                                                                 "                       *,    0Zb N ",                                                   *      $                                        . <60         0  0  ((             *                       0  "     .            .    $           (                     (                *     &                                                                                                              *  "         *   &         (  . .0         j.    (Z  @J$  $  @    & &vFP( LD"   R."@$\F0",p$  .6*"  "$j:BX<$<D0"8*046  & 6& ,$  6  , >z^ &PTb. T  0 J &(2> 0,V ,`b.,4$*  `  4`  d     @ Z:b^                r           Z`        LTR