LaI/ $1]xZHl@.textHH$1H .datal@l@]l2@.bss,`B,`BxZ.fka000L".fka040@@HB.commentm,.lib D@LB,@LB@DYB@B@B @B$@l[B(@,_B,@0_B4@0@B8@l@@ @@$`BÐETl@RU RP-:jG/c P0jUPjj j0 Ejjji uj j0 ÐUPW}ǣcB|cBE xcBcBj.Y} h @"Y'L@ } h @YjdhbB蹨54 @hbB< @@@ @\@X @bB=@tLjjh@hbBe}2h @t6YhbB6Y@h @hbB !X@hZ#hZ#;} h @BYDbBj+YWh" @h @j<贿hcBBYt%h# @76Yh_ @,6YjjaP5@h @ht @jj_YL@=L@tc5@h @h @j謿=@Wh @h @j莿~JE @=-t:jE ph @jbE pCY~E phDbB=DbBtSjhDbBh @j D@hDbB1oYjYL@=L@t=@DbBWh @h @jǾL@P@= @t=L@t[=@tt@P:1YhcBYt $#=@u h @`4Y=$@uփ= @u=$@u =P@t=T@u5@j=H@u.'-H@jh @h @jҽhcBYujh @h @j譽%=H@tU5H@h @|E}~4ju(jYL@=L@t=PA=DbBtD@hDbBRmYjYL@=L@tUh YcB=cBthYcB=cBujh( @h @j轼3ÐUPWVuV>YƍWU ;u G^_ÐO3^_ÐUl7jh @ÐUdBÐU EPhhTj% }bfEftWfEftNE@E@5@hM@h=@j5@h^@hN@jӻ3ҋÐUPWjhx@h_@j註4tVthy@h[Bth@h[Bth@h[Bj)Yjj @= @u" @jh@h@j L= @u#jh@h@j @!jh@h@jɺ @5 @jjY,jjjjjjjj 3_ÐU3ÐU4WVSu ]5 @h#@h@j6uSh$@j#5 @h>@h7@j 6hD@h?@jjh^@hE@jݹjhy@h_@jǹjh@hz@j豹jh@h@j蛹= @~ jh\@S% t5 @Y 3[^_ÐGEYBuu|SY @5 @Sh@j)jSh\@  @ @h @EP @` @d @3[^_Ðhj' dBh @jYt jYu 3` @5` @h@h@jnEP @ @x@}hj @uxYEPh@h@jh @!Yt x@*S=T @t3 Pu32Y @2uh@h@j起5 @h@h@j蛷5x@h@h@j職*S=T @t3 Pu1Y @5 @Sh@j?= @}c5 dBj=L@ u*SY5L@Sh@j[^_Ð=x@t [^_Ð[^_Ð5 @Yuhh'@SDtVSh1@h[B8 jShN@j茶5 @Y @5 dBj[^_ÐjSh\@ >EEh_@Su' @5 @Shh@jjYEujYEujY}tjYE"}tjYE jYEjuEP/ juhw@js5 @YE}tOE8jEPu u3 @5 @uh~@j @EP/YjEPh@j5 @ YEjEPuc u3 @5 @uh@j蕴5 @h@h@j{= @uQ=` @u.jh@h@jS5 @Y @5 @h@h@j! @= @ SAYEuSh@j5 @?Y @5 dBj&}uhcBh@j螳-hcBYE{-}~uh@M=cBtAhbYẼ}t-hcB5,@h%@uuWYuY[^_ø[^_Ð @>t Ƌ @h @hT5 @  @PhM@h+@j農h @hT5 @ h @hT5 @} jj5 @ tsjj5 @ %Pj5 @ } hN@Y= @t!f @h @hT5 @ jSe,PhY= @ @=T @u3Ph @uh@h@j輱}t Ef` EfH3f% @f% @h @hT5 @b l @5l @hr@hc@jO5 @h@hs@j56h@h@j5 @hcBh@j5 dBj\3[^_ÐU=T @t3 Pu +ÐUW5 @h@h@j螰= @=d @h @= @trjh@h@j[=T@t;=cBt2)hcBY}hcBh@XcB *3th@h[B= @hjJ @j YPh@h@jh @Yt7jh@h@j虯jh@h@j~j5 @h;@h @j_5 @YB*}-h\@h<@h[B jhl@h[@j= @ @jhy@hm@j3_ÐUWV= @| = @}3^_þjh@hz@j谮h@hT5 @ |jj5 @ } ^_Ðf@fEЁRh@h@jKjh@h@j5 Pj5 @ f@ jh@h@jjhT5 @ h@hT5 @ }Wj5 @8 ^_h,:Yjh@h@j蒭jh\@'PYjh@h@jffEf@h@hT5 @3 |Wj5 @ } ^_Ð^_ÐUPW= @} _Ð=d @t3_Ðh @hT5 @ Wh@h@j踬}5L@h&@h@j蚬h @_UWVSujVh'@jmt@>t;jV~hj EPW ShD@h.@j-} [^_E uEPhE@EP ؅}EWSYEuhS@hH@jͫE[^_ÐUWVSDžPT@T@cBj/uEtE@EPhe@EP EPPhm@hcBSPhs@VPjhcBh@jjVPh@j}$h$VPU}g5L@VPh@jƪ=L@uPYh@PYVPNYz$[^_Sh@EP j EPV* SEPh@jFVYh$VP3hcBVP?u3T@=T@ghcBZYE=N}uh@h@j赩L@juEPh@h@j膩5L@h$@h@jl}}c=L@uZuhcBh%@jF=\ @uuhcBh@@] hcBYEPhcBhl@jd}} =L@t}uOVPYuh@hz@jʨ"[^_uh@h@j褨=T@uG=eVP?Yk"=T@t 3[^_Ð[^_ÐU=T@t;=cBt2!hcBY}hcBh@QcB"3ÐUP3҃} t}t}uÐUWVSu = @uh@h@j跧Vh@h@j袧uh@h@j苧ED @H @=D @t L @El @=d @t5 @2Yu 3[^_Ðt t5p @= @E PYVh@h@jt=T @u 3Ph @uh@h@j踦}t Ef` EfH3h @=bBu'f @h @j5bB` =bBu#f% @h @j5bB0 d=bB uf% @ @%f  @:=bBt=bBt =bBuf% @h @j5bB f% @f% @f% @f @f @f% @f% @f% @f @ @ @= @u @h @hT5 @: } [^_Ðh @3[^_ÐUWVS} u5 @h@h@j5h @h@h@jVh*@h@jϤWh5@h+@j躤= @=h @t=;5l @u5;=p @u- @9T @u jhZ@h6@jq3[^_Ð=d @t/5 @DYujh@h[@j83[^_Ðjh@h@j= @t}ƹ EPYt$=T @t=T @u=P @t 3Ph @uh@h@j责}t Ef` EfH3Et tuh @jWe auf @h @jWE A uf% @ @%f  @uh @jW f% @f% @f @f% @ f% @f% @f @ @ @h @hT5 @ } [^_Ð5l @=p @h @5h @h@h@jo3[^_ÐU WVS]Sh@h@jA5 @h@h@j'5 @h@h@j = @| = @u3[^_ÐX3E=xtn=tQ=t4b=tA9E/E"EEE = E=t+=EE=<E=xt)G=t.=uoE hE ]E L=uAE :=t=u(E !E=u E3Wh@h@jXuh@h@jAu"jh@h@j'[^_Ðuxt|h@hT5 @ |`f%@fEf @f% @f  @f% @f  @f% @f  @h@hT5 @ } [^_Ð[^_ÐUWV5 @h@h@jY= @} @/h@hT5 @ } ^_Ð@%Wh@h@j=$|@3}2vKnnf^VN,FX>6.` &%KVh@h @jI^_U`@5@h&@h@j=@=@}øÐ @@3@%UPWhh@5 @ Wh;@h'@j觝_ÐU@@5 @hI@h<@jn= @} ÐjhW@hJ@jEjhT5 @ 3ÐU@@ÐU3ÐUjj_X@5X@hn@hX@jԜÐU WV@5@h@ho@j螜5@h@h@j脜5 @h@h@jj=@} @=@~= @u @}T}uNjjE}u 3uh@h@jWh@h@jjYtjYt3Vh@h@j誛~uu 3\ @5\ @h@h@jr^_ÐUjYuj5\ @h@h@j95@h@h@j=\ @tK=@uB5@h(@h@jjjNjjBjj6Ð5@hP@h)@j豚uj u ha@hQ@j荚} uE =@tu jjh&j=X@xX@UÐUjhi@hb@jjjuh)jfjjZjjNjjBÐUW3}|~}uK= @tB=X@t45X@hx@hj@j薙X@h&jG_5@h@hy@j]=@~=@}3_Ð_ÐU5 @VYÐUWVS]Sh@h@j } 3[^_Ð=D @tL @jh@h@j˘3E G# L @ ~3;}/ @} U@@@@%}}Vh@h@j]u~E 8}[^_ÐU WVS} = @} [^_ÐWh@h@jjuh@j}+Ph@h@j×Wu5 @ ;u Sh@h@j薗E[^_Ð}$5L@h@h@jm[^_Sh@h@jNE+~jdY~ NM}E[^_ø[^_ÐU We= @}h]-~ GP-YEPh@h@jʖ=p @u!E5p @h @h@j蠖_Ðhj @jY}3h @~YejEP5 @ =}.9WY5L@h@h @j_ WUY3_ÐUWVSEEE= @} [^_Ðu h#@h@j踕uh/@h$@j衕E}}E}t5hj @uYEPh<@h0@jSh @^Yt%jhJ@h=@j."[^_EEEPhW@hK@j=D @tL @3EPhb@hX@j”> @}k@@@@%}kSh{@hc@jy5L@h@h|@j_=L@Wh@h@j,}u%U;uE}tEG# L @ uHE@%- %E}~ 3Euh@h@j觓uu#}uE@%- %EMuF}u@kE_UR @EEuh@h@j0= @uP=P@tG#L @;T@u7E@E;X@|/}t h@h[B|[^_ÐE}uSh@h@j赒1}&E@;}t} %U;%U;t$uh@h@jPWh@h@EPh@h@j*E8H @H @uo=D @ufWEPuނ D @~B5D @h@h@jבjuh@jÑL @EZD @}t Wuh;@j臑[^_ÐE H;g [^_ÐEU$E9}|juh'@j=UW= @}_Ã}~ =@~= @} @@@@%#L @_hj/ @uYEh @Yt + @}O@@@@%j uE)E}}EuY}_Ë#L @_ÐUWVS]5 @hR@hE@j= @| |~ [^_ÐSh`@hS@jޏù34jhT5 @ }ha@Y[^_ÐG;|3[^_UhGYUh7YU(WVShr@/YE}tuYEt}؉EE uh@hu@j}~/}|/EP>YEU} } 3[^_ÐEPY}$[^_Ð+E܋;}~ [^_ÐEPY}ʐUj4Y| @ÐUPWjY+| @Wh@h@jQ}3_Ð_ÐUPjYEEPYUUPW=\ @u jYu @_Ã= @~3_Ðjh@h@j͍jh@}3h@hTW |.h@@hTW{ |h,@hTWd } _Ð~WY @_ÐUPW5 @h@h@j(5\ @h@h@j= @}=\ @u= @5 @h@h@jЌ5d @h@h@j趌=d @t= @| = @|EjYt9jh@h@jy5@h@h@j_=\ @t3_ÐE @x @F@Ph@h@j!f%F@f F@I@Ph$@h@jI@ @J@M@N@h@@hTj ~jh|[BWh3@h%@j蕋_ÐUjvYu3ÐWjh;@h4@j`E @x @f%2@f ,@f%,@f%.@5@ @6@9@:@h,@hTj ÐU5 @hH@h<@j֊= @| jYu3ÐjhZ@hI@j襊x @jhr@h[@j腊h@hTj` UjEPj, ÐUuu j ÐUPuYPuj ÐUPWVu34Y} ^_ÐG8u3^_ÐUuYjhs@j ÐU=@ujYt@5@h@hv@j胉=\ @u =@}3ÐjYÐU WVu $jh@h@j-hj @V\YPh@h@jh @YtjEPj QWh@h@j跈5L@h@h@j蝈=L@u|=X@tsA~E%^_Ð5L@h@h@jQ=L@u9=X@tX@ @^_ÐjEPj` u^_ÐUET @5T @h@h@jއT @Uu h@h@j轇} t Ef` EfH3ÐU= @tÐÐU}ujja},h@Y5L@h @h@j:jh@h @j3ÐUP+f@f@f@f@@@;u f@@@;u f@f@fuf@fu f@ÐU@=t@P^Yt Ð@=t6@PYt$@=t@PYÐ3UPW3@=t@P>Yt@=t@PYt_UÐUPWu u}_UWV3iu @;t@;u>u @;t@;u ^_ÐU@UPjEY= @t5 @jI @Ðjj.ÐUj"PPYUWV}u WVh)@j苄4P@h)@h)@jpW}|} |EE|[B9P@tl[B9P@t4P@jV輵؅}5L@Vh+@ SVh+@jZyVY} [^_Ð3[^_ÐUuYÐU WVS}E3ۅt} u[^_Wh+@h+@jxu J= ~E}u =!|&EYBtPYFCGt;D@|N=!};u wE uh+@u ju h+@jSx[^_ÐUWVujVh+@j.xX @=~uFjVh+@j x=/u X @ GA9uE X @j0h,@jw^_U WVS3juh(,@jwX @}o=/u 3۾X @XEYBtPYF7=~t =#t=.uC=~XFFGu} X @=.uXGhX @W蓴ju h.,@jv[^_ÐU WVS]jSh5,@jvt<,@tu؉]jSh=,@jvSYujVhF,@jtvVɲYtl}EYBt PVYG?ujVhO,@j.vuYuujVhX,@jvV]Yu [^_3[^_ÐUPha,@谲YЅtÐf,@ÐUPW\!@hhu,@hh,@juhWF_U WVuV}|} |Eԃu֯Yh,@u贽P@p@cBcBcBYtMWPPYt*Ƌ &@9PuPh %@贚 %@^_tMWP萚PiYt*Ƌ &@9PuPh %@\ %@^_5 &@aYu %@ &@3^_Ð6h %@ %@^_U WVSuPVh 1@j[\=~t [^_ÐVh&@șu '@[^_V軙YE3>=/tNJ>(@G;}|Ƈ(@uOPh(@ZY؅t;Vh&@`sh'@PPh'@/'@[^_ÐVh&@%Vh'@'@[^_ÐUWt}b_Ðth1@vYhڵYjuhC1@h@1@h81@耵hF1@Yh訵Y3_ÐEPY;uE_UW茵ujEN1@tjYhV1@芗YE}u3POYE}t E@ 8u EE E@ EEEEzu3_Ðjj辗Ejj诗EjcYE;t}uuj芗uj}_ÐEE=/uEEEu}t Eujh\1@uu,juh_1@uujY닐U =L@tyuYE=\}tohwYEPxYuut 3EuYEÐE=*t=?u ÐEEEu3ÐU$WVut>u3^_ÐEPVZWVhb1@jXu#5L@hy1@hm1@jX3^_ÐEPh1@hz1@jXE%=@u ^_Ð3^_ÐUWVSuYSuh1@j(@2 cB|cBcB%E|hcBE# @E3EEEEE=H@=@u E= tZU;uO=(5@uF@@@@@=^,=@@^u[@@@ %E@@pcB@@4=@@~+@@@@@@ %E@@pcB@@=@um= uc=@t9=85@t0=0@tG,@G@OG85@f=2@tG@MG G %Eétq=@tP=85@u@hYE}u =0@uEN85@=0@t,@EEe=0@t\,@EEM=@tD=85@t;jYE}u =0@uEO85@=0@t,@E=@t}t }t}uEPfjSVj15,tBx[Y3[^_Ã=@u=@u 5x@ӜY5,tBG[YjSYEP-YjuhG8@j0j=@t l8@s8@PhZ8@jv0jhy8@hx8@j`0jh@aBhz8@jE[^_ÐUW5@h8@h8@jD@<,uBWh8@h8@jD}&@ tBPVYPh8@h8@jDRRYP5@EP8_ÐUPW=,tBWh8@h8@j?D~WYYjAY_ÐU WV4wB,wB85@0@:@j?t:1@P:@jh:@hs:@j*4wB0@jh,vBh:@j*jjh:@h:@jA?tP1@:@jh,vBh:@je*4wB0@5@h;@h:@j>jh,vBh;@j>j5,wBh;@j>=@u0=0wBt'=,wBt5,wBjjj75,wBh,vBjjj7h,vBu{=0@ut=@ukjh,vBh+;@j<>h,vBY}FjhN;@hA;@j>jh,vBhO;@jI)1@t;@0@3^_h,vBh8wBi{juh;@j=hcBAAM@M@@PcB5PcB1Y^_ÐU WV5@uh;@jG=50@h;@h;@j-=A85@=0@tujh;@h;@j<A=M@#t=M@t =M@?u A5Ah;@h;@j<TcB0@3^_Ã=@tK5(@h;@h;@jx<5,@h;@h;@j^<j58aBh;@jG<=(@u8aB=Du3(@=(@u =,@t3A=AuTcB5,@h<@h;@j;=(@u =,@t3PpY}=AtTcBA=At=@tju u =Au @E xHpLFE=MuSh@aBV} Ajh@aBh<@jR&jVh<@j@&h@aBYiE=Pu^h@aBVV} Ajh@aBh<@j%jVh<@j%h@aBUYt uWh5<@h(<@jm:@aB^_ÐU0@3,@(@EU W}85@3=X@tOX@8tE5X@5X@h6<@j9h5X@Psw X@C<@5@hR<@hD<@j9=@tuPh@aB<jhS<@jm9u Dž`<@u Džh<@hPv h@aBPv=@t250@P150@Ppv0@jh@aBhp<@j8jPhv<@j8h@aBhYt"=@u=D@~5D@Y}3_Ðjh$4@h~<@jQ8$4@RY58@5`B5@tXFP+=@tCh@aB5@jFjz0Pjjje0h<@5bBjjN0jh@aBh<@j"jPh<@j"=@t5@h<@h<@j"Ejh<@h<@j"-h$4@5@jXj/jh$4@h<@jr"PcB@PcBP6+Y(5@hcBAAM@f@5@h<@h<@j6_ÐU WV5(5@h<@h<@j65$5@h<@h<@j{6=(5@u $5@=$5@t05 tBh<@h<@jE6@9 tBuk^_5dxBh =@h<@j65dxBVh=@h =@j5j/5@h)=@h=@j5}3^_Ã=(@u =,@t:=@p$5@5(@h@=@h*=@j53^_Ðj5@oЅu> tB9@$5@5$5@hR=@hA=@j053^_Ð58@R5@jD(ЛWh_=@hS=@j4 N^_ÐU85@}tIEt@uj5@jZZ( @jh=@h`=@jTcBh=@j5@jZ(0@3ÐU5@:FY}!5@h=@h=@j*4u@YÐUP-Ѕ}5@h=@h=@5@h=@h=@j3uYÐU@-}Ðh=@j5@jBP'0@3,@(@>3ÐUP=@^~ hxB~@@ %hxBj5 @%@ %ixB@@ %jxB@5@%kxB@@ %lxB@mxB4@-|0=w)|%$5@=\@t<@&&,@5<@h=@h=@j25,@h=@h=@j2=@u nxBN <@nxBnxB45@= @u B @@0oxB=L@t*=H@t D@pxB@D@pxBpxB =@t@3E=@t |@3 E=h@t d@3 E=t@t p@3 E=@t @3U ЍB %qxB=t@t@@ %rxB=@^~ @H@@_@ %sxB@B %txBuxB0vxB_wxB_xxB_=@t 3 E=@t 3 E=@t 3U ЍB %yxBzxB=@t/jhhxBh=@jy0hhxBnYPhhxBhhxBhsBmhxBUWVS]jSh=@j)0K=`B|C- %P@E=@t;=@}=@ }Pǣ@@@=@u%=`B|C- %@} @ǣ@5@5@!@@@=`B|9C- %@=`B|C5@%@@=@t0E@P[YU`BE@9E|܃=`B|C- % @@=r@=v@ =`B|C# ~?| _~ }#@=`B| C38@=8@Yu 4@:=8@ ~ =8@?|=8@_~=8@} 4@ 4@58@h>@h=@j-5<@h>@h>@j-5,@h>@h>@j-54@h+>@h>@j-4@t-=t2=ut<@9,@t =<@YuID0@I=\@t@=45@t =45@&u.0@,@&30@t 8@,@=@u0@,@N=`B|*C=Bu  {0|~= @H@=`B |C E=L@tf @=YuE@;uRH@FE= ~=?|E=_~)=}"H@ED@ H@@3x@l@@=@t @ =`B C - %Wh7>@h,>@j+#|@t=@t 3@#d@t=h@t 3l@#p@t=t@t 3x@#@t=@t 3@5@hD>@h8>@j+5@hQ>@hE>@j*50@h^>@hR>@j*=@t-#@t=@t=0@t 3@5t@hk>@h_>@j*5x@hx>@hl>@jp*5@h>@hy>@jV* F3- t95`B}Vh>@h>@j!*5l@h>@h>@j*=l@t{F9`B~pF- %k_V ‹Wh>@h>@j)=@;}E@=@ } @P@@5@h>@h>@j_)5@5@@=t@95`BF- %Wh>@h>@j) ~$ @#~ @#JAǣ@@9@~ @@=@} @=@~"x@@9@~ @@@Wh>@h>@jj(D@Wh>@h>@jH(x@5@h>@h>@j$(=@~J58M@5@5@ ;=@}&ǣ@@5@h?@h?@j'F9`B~F- %0]@=@t 5`BY@@3[^_ÐU WVS35sBh,?@h?@jb'bB=sBu<=H@~+tcB0h@aBdH@[^_Ð3[^_Ð=,@t7jhC?@h-?@j<jhR?@hD?@j&[^_Ð=sB5H@h`?@hS?@j&H@ H@tcBtcB0h@aBd5H@h@aBha?@jX&=P@ubh@aBִYSh?@hv?@j-&uh@aB3Yu } [^_ÐsB=sB}ah@aBYSh@aBh?@j%u;sB5H@h?@h?@j%@aB[^_Ã=sBh@aBYuCjh@aBh?@jL%Wh?@h@aBjh@aBjjj|=bB[^_Å<@aB3[^_Ð[^_ÐUH@@5p@h$4@Qb(5@sBE 4@=@t@@@ÐUWVU- %@zjWh?@jW_YtVqjVh?@j$$V_Y58@GYVjjjjVh?@j8^_jWh?@j#jWh?@j 3^_ÐUPWVMu t9u3^_Ð$4@GAuGF҈ujh$4@h@@ji#h$4@jʭ~gjh$4@h @@j@#sBH@@@=@t@@@^_Ðjh$4@h0@@j"3^_UWVSEE- %؋uFu^YWuhD@@j"jVhK@@j|"===p=/=tx======t/=;V]Y@@[^_Ð=yV]Y@[^_Ð=tQ=t(^=?V]Y@@[^_V]Y@@[^_ÐVc]Y@@[^_Ð=V<]Y@@[^_Ð=t)C=V ]Y@@[^_ÐV\Y@@[^_Ð=mV\Y@@[^_Ð=:tu3=6tP=-t#q=,"V}\Y@[^_Vg\Y+Љ@[^_ÐVG\Y4@[^_ÐV/\Y @[^_Ð=.V \Yu @u @=@[^_Ð=8t%;=7dV[Y@[^_ÐV[Y@[^_Ð=9)V[Y@[^_Ð=/=t(=;VB[Y@[^_ÐV+[YE}}}~E @[^_=B @[^_ÐVZYE}p}c5@u @[^_Ð=5VZY@@=@@#~ @@#=@^~ @^5E@t@55`BY5`B3Y}} 5`B2Y5|xBhsD@h^D@j=|xB}W5|xBhD@htD@j5 tBYAhD@YhD@54@*YE5 tBhD@hD@jq5 tBVhD@hD@jN<,tBUVhD@hD@j/,uB|(M@|u$VnYVhD@hD@jF@;5`Bs^=@~[ tBH@hH@jA 4(M@U\(M@UM L(M@UML$@3G<@GEGU R GUE(@E}t]E_EE GUR EB %G;EPY@ %GEUR"}};$@H'=$A@EPY@ %GEPYEGU?R GU?R EPYEGU R GU?R GU?R CEPYEGU?R!GU?R!G@;Su js \@=et =mt)=ot2=suWGËJGËDGËDGË@@5N;s&N;s=,@t 5,@xY=@t5@h`Bp=$@(M@U $@L 5$@So} [^_ÐE@@$@\cB$@dcB jhZH@h?H@ju Sh[H@jSu EPj1$@[^_ËEE;GEMu<@@N;sN;sUWV}WY%%?^_UWVS}=\@t 3 #Gu%[^_ÐUPWVS}=\@t 32#3Ë%ցA@3PA@3‹Guɋ%[^_ÐUWV5@hwH@hiH@ja5 tBhH@hxH@jG@@@W"Y}VhH@hH@j^_Ð=@5@hH@hH@j3^_ÐUhH@5 tBUWVS}Wu hH@j4,tBVhH@hH@jWCYWtY}WhH@hH@jgu u BYPWjY5 tBhH@hH@j5WhH@hH@j ;= tBu,~VY~SY tB@@ tB3[^_ÐUhH@uÐUjuhH@ju5 tBÐUPWVu|?~VhI@hH@jx3^_ÐVhI@h I@jZ,uB}-V8Y}Vh"I@hI@j-3^_Ë<,uB(M@LD; @~ ^_Ðh#I@jVjN3^_U9@|L5@@h6I@h$I@j5@hGI@h7I@j=@@t@Ð@k@=@} @@9@~ @@5@h\I@hHI@j*@@ÐUWVS]ShhI@h]I@j5@5 tBSA u<,uBu=<@uv=@?}m=sBtd(@E$@E(@$@hsBhsB?YPjjY hiI@Sj# E$@E(@hyI@jSjY@hzI@5@j%j3[^_ÐShI@hI@jVhI@hI@j3[^_ÐVhI@hI@j(M@LD; @~hI@54@?[^_á(M@thI@hI@j](M@Ѓz uJ=<@t9SY@hI@5@j%j(M@D[^_Ð3[^_Ð(M@t (M@th@hI@5@j%jF(M@tSjSA (M@D[^_ÐUWVu輩Y58@5`B5@jE=@@4j4Y=@=,]@} ,]@ @A^_ÐUu IY}Ð58@5`B5@EP3ÐU5T@ Y} Ð58@5`B5@jRO3U WVS5@hJ@hI@jxEPhJ@hJ@j[}} [^_Ã=4@t4@,M@U4aB4aBE4aB8aB`B`B=h@t l@ @E5h@@@PEP5@,M@UDHP54aBhD @9\@t `@D @\@Vh#J@hJ@jiu*Y}P5@h4J@h$J@jA5h@hEJ@h5J@j'=@t =h@t [^_Ð=<@thFJ@5 tB hGJ@5@jTjhhHJ@jjrk =bBujfYT[^_Ð5(@`cBXcB@}4aBG- %Ep@#~ Q[^_Ð4aB0ء4aB04aBEPYS;t$uYhRJ@jjr Q[^_á4aBӈ04aBV- %k_4aBN +(@`BW};VhJ@haJ@juVYhJ@jjr Q[^_Ð+(@-`B34aBG- %`Bu5`Bjr =`B| =`B?~D5`BhJ@hJ@juYhJ@5`Bjr Q[^_Ð4aBGE@9Et=<@tF}Nu@uhJ@hJ@juYYhJ@5`Bj# e[^_Ð}It}SuE`B(@H`BF}Nu64aBU- %-E`B(@+E`B (@E5(@hJ@hJ@juhJ@hJ@j4aBǣ8aB5`B,M@U;t~@Vh K@hJ@juWYh K@5`Bjr Q[^_Ð34aBEPYU ;pj4aBEPh+K@j%E- %PhEK@h9K@j4aBEPYPhPK@hFK@juYhQK@jjrd Q[^_ÐE- %U ‹ء4aBEPTY;}EuE4aBFM 4aB04aBEPYU ;nN4aB0j4aBEPhaK@jSh{K@hoK@j4aBEPYPhK@h|K@juYhK@jjrf Q[^_ÐE- % U  U ‰E4aBEPY9E}EuU4aBFM 4aBFM 4aB04aBEPYU ;P4aB0j4aBEPhK@jE- %PhK@hK@j4aBEPYPhK@hK@jus YhK@jjr8 Q[^_ÐE- %HU J ‹ء4aBEP&Y;}EuA4aBFM 4aB04aBEPYU ;tDN4aB0ShK@hK@ju YhK@jjrz Q[^_Ð5`BhL@hL@j`B,tBtK@5`Bh)L@hL@jh*L@5`Bjr S2 Y,M@UD`BU,tB,M@ `BL,M@UML,M@U 8aBLu5`BEPjE[^_Ë4aBDC;]|D4aB0}u&=$@uEjh*K@hK@jEH|=w |$A@uH YhK@jjr Q[^_U=@E8} }'f<REPh6L@EP2(f<Ru EPhBL@EPk2EPjZv|ujv} @ÐUEPqfYjhQL@hPL@jjuhRL@j9PcB=PcB~nPcB+TcBPhL@hgL@j5lcBhL@hL@jy5`cBhL@hL@j_5dcBhL@hL@jE5@hL@hL@j+=@~AklcB =@E PhM@hL@j=X@ #TX@jh M@h M@jÐUhcBlcB=0@u,=(@u#=,@u5hcBhM@h M@jÐU WVSuhN@hN@ju hN@hN@j}P} P=(M@uh/Y(M@u hN@Y3(M@DG |=,M@uh/Y,M@u hN@aY3,M@DG |=0@u'E @dPX/Y0@=0@&0@=4@u"jQ-/Y4@=4@4@=@M@t5@M@.Y@M@EE p(EE X(Vh O@hN@jShO@hO@j;tMjh/O@hO@j0VhMO@h0O@jvu3rGV`.Y@M@tVh]O@hNO@j7kEMM ؋ƹË} [^_ÍG8M@@M@0M@58M@hoO@h^O@j+-5 tB5dxBhQ@hzB"$hzBjh3^_Ð(M@t(M@t(M@t(M@t(M@t (M@t(M@44yBWhQ@hzB#,hzBjugAUWV=@u@hR@jg|h$R@jg|3a,M@4#Y=H~ R@R@P,M@4hyR@hzB"hzBjfdG;=@|;5 tB5|xBhR@hzB"hzBj}f&3^_á,M@t,M@t,M@t,M@t,M@t ,M@t,M@44zBWh[R@hzB!,hzBjeUWVSdPxY| } [^_3=@tA8@F.8@FMčI 3EȊ88@F G;}|=@8@F"=@t&8@F"8@FB8@F8T8@F#8@FA8@FM8@FJ8@F*8@F!8@FA}r}h=@tMp~A8@F#8@FK 3t88@F G;|=@8@0!dhR@F8@P% 8@ƍ@P0 Y؍F8@S C8@01uhR@F8@P 8@ƍ@PY؍F8@S C=@t[=@tR8@0(5@hR@F8@Pr 8@ƍ@P}Y؍F8@S C=`Bu =`Bty=@tp8@F+hH{B0Y@!%8@F =`Bt8@FP8@FM38@FH{B GH{Bu=@u$8@F+8@F!8@FR8@F@8@F 8@058@}Y؃=@_}\ @-+(@;~@hR@j5@jAXShR@hR@j5@hR@hR@j%58@S5@jAS58@hR@jR3[^_U=M@u }S@ÐUB=Nt S@ÐE= ~,EM@m!E;M@w HM@S@ЋÐU W}PWhS@j=NuDWbYDM@j5DM@hS@jj5DM@hS@j_Ð=@=1GEE- %EPhS@hS@j&EkE UE0‰EEMuhS@hS@j}~ED@5D@hS@hS@j=D@~5D@躇Y}3_Ã=AuhS@5bBjj DM@S@3_ÐU@WVS]E E@aB=@u=0wBtE,vBE(N@ENEċEE333m33A= N@ujeY N@u hT@Y33=$N@uhY$N@u hT@uY33 NJCTG;}(|D=;}+؍EPYU BxE pxEPh U@j<#-!|=w|$,]@=@5@5@萻@f=@w&~^&<@,]@X@'d@D]@ }#&<@D]@ }%4]@ 8]@jI薃YT=@%w}%<@,]@X@(d@D]@ ~;}%4]@8]@CjI"Y=@h%}O%<@,]@X@)d@D]@ |%4]@8]@KjI讂Y}p=@$|$<@,]@X@*d@D]@ W|$4]@8]@GjI>Y|D]@b=@w$|^$<@,]@X@+d@D]@ {#$<@,]@X@,d@D]@ =8@u {#=\@t$(@E$@E$@(@h-d@Y=\@t\@E(@E$@h0@hj@fYhbBYhj@Y=@tj蛔Y @=@=@=\ @L@=vu)hj@KYh4k@@Yh5k@5YL@=su&hPk@Yhk@ Yhk@YgL@=gtL@=rtL@=cu:hk@Yhk@YL@=ru k@k@PYV=@t(=@u=\ @uhl@`Yhl@UY=@uh-l@jjj覗@ÐUE#E t Ð3UhY{BhY{B{BjhY`l@txhY{BtdhY{BtPhYdl@t3l@<tl@4YG;=tl@|5l@Yl@Etl@|l@l@}~Ctl@@PYl@=l@u_3 l@G;=tl@|3_ÐUhu5pl@ pl@ƀ{BEl@hl@EPuU } ^_Ð{BEWuhn@j茑u 5Yt jV){BEjuhn@jTu7Ytuhn@l^_Ðjuhn@ju 8Yt'juhn@jEU^_Ðhn@ubt5hl@YY5hl@YEE9E|ݡ`l@Xl@Xl@5`l@h/t@9xUWVS33@l@Hl@E5{B衭Y*tl@H9l@l@8t l@0腬YE}un=4l@teta}?u[ |[B}h|[BEP轫[B[BUl@j5l@{B[^_Ã}uR}u,l@j5l@{B[^_ |[Bh[B[B}t }{B9l@v?=Dl@t ht@Y l@l@= u Hl@l@y |[B}h|[Bj質[B[B@l@Hl@{Bl@l@l@{Bl@l@{B3Ɉ l@9l@}b}{B9l@ |[B}h|[Bj[B[B@l@Hl@{Bl@l@l@{Bl@l@{B3Ɉ {B[^_Ð}u*l@5ll@ht@w{BE=tl@}t }=|l@}" |[BN[B[Bl@|l@<t/5{Bl@|l@4Eu=|l@~" |l@l@|l@< |[B[B[B=tl@}u|l@@;l@~ |[B[B[B|l@l@|l@<t&5{Bl@|l@4{u|l@l@|l@<r} }Du@u l@e |[B}h|[BjçH[B[B5jEPZl@UBl@M܉Eܡ|l@9E| l@l@l@|l@5{B賨Y@PYl@ |l@l@|l@<t5{Bl@|l@4l{B[^_Ð=Dl@t ht@Yl@l@ l@;{Bw@l@Hl@{Bl@l@l@{Bl@l@{B3Ɉ Hl@{B[^_Ð l@{B9l@rSl@= tB=Dl@t ht@"Yl@뾐=Dl@t ht@Yl@ l@{B9l@rl@= ul@Hl@{B[^_Ð |[B}4h|[BEEYBWt E^Pm,EEYBWtE^[B[BE܊E܄Euh|[B肥Y=Dl@t ht@Yl@l@ l@;{Bwѡl@|l@45{B@5{B5ll@ht@ȥ |l@{B[^_Ð=Dl@t ht@薥Yl@l@ l@;{Bwѡl@|l@45{B5{B5ll@ht@H {B[^_UPWM3l@l@AGt{B9l@r֡l@ l@l@l@l@_ÐUWVS}@l@5{B;udl@EVu}} t-WYENjU= uM}E@G= t3U={uC=}uKu.= t = u} t%= t= tFG@l@?u@l@[^_ÐUUEYBu3ÐB:uÐUP l[B}hl[B莢YÐp[Bp[BU |[B}h|[BEPmÐ[B[BUÐU=Dl@t ht@KYÐU=Dl@t$}  |[B}h|[Bj Ð[B[B |[B}h|[Bj [B [B |[B}h|[Bj蹡[B[B |[B}2h|[BEEYBWtE^PqÐEEYBWtE^[B[BÐ |[B}h|[BEP$á[B[BUÐUWVSE9E8u*=1 =0G=\{uGEE=8F=4tx=2to~=3tf=6tV=5tM=7t>w=XtP=Dt( =9t Y=Ot!O=ot=du@5xAhAPEPhT@hI@jZuIYÐh|@>YÐhU@YÐh@YÐh @YÐhO@YÐh@YÐh4|@YÐh@YÐhz@YÐhI@YÐhX|@YÐh~@bYÐht|@~YÐh@BYÐh|z@^YÐh{@NYÐh@YÐE}EÐ5{BhX@襖A3ÐUWVS]oE}E[^_h|@gYE3~4h~@L4襖YEE38= uEG;}|EEqA-9E~'ÍV8t@u 3[^_ÐEF8xh@ǕY3[^_ÐUP}Ðuh@蜕3UPW}uhw@Y_Ð}_ÐW}_ËH'=D$́@hP@Y_Ðh~@Y_Ðh~@~Y_Ðh8@nY_Ðh-(A2Y_Ðh~@NY_Ðh)AY_Ðh@.Y_Ðhx@Y_Ðhz)AY_Ðh3*AY_Ðh*AY_Ðh1+AY_Ðh\x@Y_Ðh+AY_Ðh,AY_Ðh@Y_Ðh@Y_Ðh[,ARY_Ðh,ABY_Ðhy-A2Y_Ðh{@NY_Ðhy@>Y_Ðhx@.Y_Ðhy@Y_Ðh3.AY_Ðhw@Y_Ð54 @h.Ay=< @u)54 @h/A]h6/APYh/AEY3_Ðh8@Y_ÐhX@Y_Ðh0AVY_Ðhp@rY_Ðh0A6Y_Ðh0x@RY_Ðh1AY_Ðhb1AY_Ðh1AY_Ðh@Y_Ðh,@Y_Ðh@Y_Ðhy@Y_Ðh~@Y_Ðh2AY_Ðh@Y_Ðh@Y_Ð5{Bhl3A3_UPW}uhy@mY_Ð}_Ð H =$@h4AY_Ðh,5AY_Ðh5AY_ÐhK6AY_Ðh6AY_Ðh%7AY_Ðh7AY_Ðh7AY_ÐhY8ArY_Ðh@Y_Ðh9ARY_Ðh9ABY_Ðh:A2Y_Ðh:A"Y_ÐhX;AY_Ð}_5{Bh;A詐_ÐUAsE E2=5qAhHAhHAjh>A3EV E EAA[^_Ð[^_Ð5qAh_HAh^HAjh`=AE]EMEp@A[^_Ðhp@YA[^_ÐjhdHA5{Ba~ 5qAEPj 5{BhgHA׬EPuht@ A[^_Ð5qAEPj hHAhHA虬Ejuuh@A[^_Ë== = a==+=B==H==#V=(=<l=AI5qAhJAhIAjh?AAE(EhAYA[^_Ðu Y[^_Ð5qAhHAhHA5=Ah=AE mE]EbB=bBuf&3@f"3@f&2@f"2@5bBhHAhHAj>A[^_Ð5qAhHAhHA5X>Ah=ADE+ }uQ5qAEPj hHAhHA螪E}| }~}thHA{Y[^_ÐwEg}W~3h@El@A[^_Ð5qAhIAhIAjh?A|Ec Et3= A{BRYA[^_ÐhTAYA[^_Ð5qAhIAhIA5BhBE E E@PBA[^_5qAhIAhIA5>Ah>A蘽E %E E\@t0@0@qjEPh8IAhIA{E uYYEP7YA[^_Ð5qAEPj h]IAhBIAqE}}Ehuuh@EJ @9@h`IAIyYA3[^_Ð5@hIA5{Bey } t-hIA5{BhIAjSR L@L@[^_ÐEA[^_Ð5qAhIAhIAjh?A E Et#=t h@ZYA[^_Ð{B{BjhIA5{Bx 5qAEPj 5{BhIA%E }}hIA,xY3[^_Ð EU uhIA5{BDx } t,hIA5{BhIAjS1L@L@[^_ÐE@A[^_h@jYA[^_Ð5qAhIAhIAjh\?AEE=, $ $\AAhAYA[^_ÐA{BRYA[^_ÐAA[^_ÐAA[^_Ð!u'E}~ 3AE[^_Ð=/=J,=ty{=5qAhLAhLAjh;A萹EhvYE}u"hLAvY[^_ÐO[^_Ð35qAhOAhNAjh4AٴE} E[^_Ð}u"YEP@5qAEPj h9KAhKA Eh}~}th;KAqY[^_Ð5qAEPj hKAhlKAE}}hKApY[^_觻EP@ET@EX@}Z5qAhKAhKA5<@Ah@A貳E?E/}u 3@}u3@A[^_Ð=;tm=1h5qAhJAhJA5>Ah\>AE詺EEAA[^_Ð5qAhKAhKAjh>AIJEQEAEL@A[^_Ð=D5qAh[LAhBLAjh;AaE|LE5qAEPj hLAhbLA轝Eh?uuEPE}} E[^_Ð}}EE,sAA[^_ÐoE_5{BhaOAenA3[^_ËEf u2@f PF|Et=t [^_Ð5qAEPj hMA}u LA]MAP͜E}}}t u;mYj5{BhMAjx0jhMA5{B t2jhMA5{Bʠ tjhMA5{B豠 u"IE|=E83hfNA3mY[^_Ð}t ulYE[^_Ð+EE}~ }A}~ }+E9E}E%E}uI}t=bBu:}t}u.=At hNAlY}t ukY[^_ÐEUfMf P9ƋUfrfE2@F|}ukYEfUfE2@E} |EEfUfE2@E}|fEf3@=bBuB}u<=AthMAkYh-NAkYf&3@f"3@f&2@f"2@A[^_U WV=@=AE=@u E-g~ %E= @~3E}thbBhOAj}jPhA聐}tOAOAP1Y35x @YjwYjhOAhOA5AhAޭ}!u hOAwjY5x @ʑY M|hA轏Y^_ÐUPW@PhPA.j3GE2@PGP}2@PWhXPAiu2@PhmPAi hwPAiYE2@PPE2@PPhPAiu3@PhPAihPAuiYGIhPA`iY_ÐUWVS5|cB=xcB=qAuh iYqAu haAYh6aA5qAki'@؋==t=-@[^_ÐEPhJaAh>aAj~+E=Rt<=StA=YtF=dtK=ht8=yt]=z@z@lT@`5qAEPh{bAhbbAG5qAEPhbAhbA'Ѕu1uhbA`_ÐuhbA`_u5{B`{BE5qAhbAhbAjhhTA跣| G}_ËE=w^|Z$TAWu@_Wu;@_Wu@_Wu@_ø_UPWj4YEu3_Ð} tbTATATATATATATATATAhTAjjujž~uh0|B_ 0|B_UPWjxYEu3_Ð} tbTATATATATATATATATAhTAjjuj~auhd|B^j5p@hcAju jhcA50 @j^ EPΒYjhcAuj@  d|B_UPWjpYEu3_Ð} tbTATATAUAUA UAUAUAUAhTAjjuj~uh|B] |B_UPj赞Y} tbUA UA$UA(UA0UA4UA8UAdAKdACdAPYYU=bBu=@uָPdAܐ=bBu=@t XdA]dA붐5bBhddAmYhgdA`YY=h@t5l@hudAFY hydA7YY=@=@=@u EdA0=@u EdA=@u EdA EdAuhdAX=@u+=@t5@hdAX hdAXY=T@t=cBthcBhdAuXt@5@%P5t@hdARX UhdA@XYU=@} =@tUP}tE8u\h'eAiE=~5=}. |[B}h|[BPV([B[BUEPh/eAWEEEuh5eAWYÐU=$ Bt$ BLeAPh7eAqW= BteAeAP= Bt |eAeAPhSeA5W = BteAeAPheAW= BteAeAPheAV= BteAeAPheAV= BteAeAPheAVhfAVY5@ YPdYhfAzVY5@=YPFYh*fA\VY50 B/Yh9fAEVY= B~5 BhIfA+V hPfAVY=AtAnfAPhYfAU3ÐUWVhufAUYhfAUY=@t hfAhfAUYhfAUY=@t fAfAPhfAUhfA|UY=@th|BhfAcU hfASUYhfAHUY@t=ufAfAgAVhgAUh gAUY=@t h0|BhgATY5D@h$gATh;gATY3hgAhgATPhgAhgATS=@t gAgAPhgAS=@tgAgAPhgARhgARYAlUh\hARY=@t5 @5@5@hhA5 @5@5@hhAR5@hhA~R5@5@hhAeR = @uhhAORY5 @hiA9R@P@Ph.iAR 5x@hEiA R@@P<@Ph_iAQ 5@hviAQ@P@PhiAQ =0@t5,@hiAQ5@hiAQ5@hiAzQ=H@t5D@hiA^Q5@5@hiAEQ 5@5@hjA,Q 5u E6LYE}}3EuhHnAh@nAjE)ƋU4@LYPƋU4hInAjƋUBU<uuhYnAhLnAjk5HAhgnAhZnAjQ}EEEEDE}|{BA<uWE3EEYBtEPvYUEE8uϋE@EЋ҉UuݡAPAE}B(sAE9E~ E+EEPhqnAhhnAj^ =@tu|YEPhnAhrnAuԃYEPhnAhnAj }ME#@E$sA}s~EEu!}ME(sAAAU(sAsA9ArArAAƀ=HAtTYATYAUTUA=@t(=Au E= tX]AX]AUXYA}tE{BA<u EEYBtEPuYEEPhnAhnAj ExE|;PhnAhnAj E;;t-}+OE;;uWE+NjRS!I uGԊ;u E%E|E@EЋҋk}uE@}B}=TYA~hTUA5TYA譀TYA=X]A~-5X]AhXYAjY } @X]A=@t1xqEEt%uhnAhnAj 軀E}~E{E;E=LAE+E;LA=TYA~hTUA5TYATYA=X]A~-5X]AhXYAj } @X]AE[^_jyYEMuU WVSu EVHGYEPVhnAj E3{BA<ulE@PFYE}uhnAFY>EE.EEYBtEPu͋EuACEsArrA{BA<u EEYBtEPqYEEPh oAhnAj>PhoAh oAjE>;t-}+OE>;uWE+NjRV F uGԊ>u E ;A.{BA<u}t uDYE[^_UPWVuE \]At =\]Au ^_ÐV{EYu\]A3^_ÐO\]A\]A>>h\]AV^_ÐUTWVSu] }uEoAVuhoAjxj3h!oAjeEP5dTAuh8SA迥E܃}} (oA[^_Ð=@E5 Au5B<: ~Bk DoAE3 ugYE3 EĉEPUDYEEoA} E}BE%uYPhoAh}BC 3 E}BEugY3 uCYEEȉEPCYE}} oA[^_Ð}} oA[^_ËE+EEE~'u苣YtuBYHE}}E}|E9E~ EoAH{BA<uuǣYu辣YEEEEoAE EoA3 E}B|LuBYEuBYE}3 uBYEE+E@E}| }t}uuuB EĉE u脢YtKuAYE}|-}}$E}BEEUEE}BEpA EpA3 EpAuBY~&E}BEE%PhpAuA 3] E}BuAYPhpAuA 3N EĉEE}Bz u蘡Ytu苡Ytru@YEu @YEE=t=t%=u&E}UE9E}EEE9EE}Buh pAu@ E pA3, ~u@Yt u肜Yt%}u/~*u@Ytu]YuE pA E}Bu@YE}u7~u#?Y~ u ?YE-~ u>YEE+@E}}Ey E9Em EEHEE> EĉEE}B EpAuY um>YE} E}BEu?Y E E}BEPu3 }Bu E}BhuuQ?  uDY u=YE} E}Bu?Y} EE}~E~;}~}}u Wuu> EE2 )}E7 E}BEy uϕYPhpAh}BA> 3R E}BE= uYPhpAh}B> 3|t t=YG;|=w | $`]ApA[^_ÐuËU4h)oAj-E9u|ރ}u;t[^_ø=oA[^_Ð}REtE8u >oA[^_ÐE=\uEEE=%E@EEE?oA}3E=0|.=9'm0=PA|0kPA(BUE%EEYBtm EȈBE}@oA[^_E=&uuEPEPu%c } AoA[^_uuEe~.maEU9B|,BE}t E[^_Ã}LBoA[^_EEu;YEUDċE|u3#ËU<t`oAE} u }tbEE= tE= tu;YHE EUM}~EU= t܋E= t΍EPEPu }uh|oAhaoAj3uEth~oAjE9u=@tEE7uËU4hoAjauEthoAjHE9u|ŋE|t t9YG;|}oA[^_Ð|t t9YG;|}oA[^_ÐEME= tEEEE= tEEE9E|E= uEEEoA}t#E8t5 Au5B/ EoAuWgE\a=~EBEj"Y&dEBuVPA@BE}u@EoA7jhoAhoAjhoA8Yc=EoA3|t t:8YG;|}oA[^_Ð|t t8YG;||t t7YG;|}oA[^_ÐuEEPu8 u'E@EPhoAh}Bs8 E}BEE+E9E~t|t tr7YG;|S{BA<tuuu<8 u>uuuk u'}tuuu8 EEEEEEUEEMuE3|t t6YG;|E}B}B[^_Ð|t t6YG;||t t6YG;|k|t tn6YG;|OEEYBtEPbYU EUEEE8uE3|t t6YG;|E}BE[^_Ð|t t5YG;|E9}}EEUE҈uEE}B3|t t5YG;|sEEYBtEPaYU EUEEE8uE3|t t*5YG;|EĉEE,E-}B=| EpAEEUEE9}|EE9E|E3|t t4YG;||t t4YG;|~EEUEE9E|(EEUEE9E|WuuR5 }E3|t t64YG;|+|t t4YG;|E[^_Ð|t t3YG;}|uh^oAhCoAj1_oA[^_Ã|t t3YG;}~}oA[^_ÐEE= trUWVEE{BEPEPu }+E{BEP54SAuhPA =8$]APA4dBhpAh{B3 {B^_Ð5cBhpAh{B3 {B^_Ð{BA4hpAh{B~3 {B^_ÐEPgY}EE8E@{BE@ {B{B E@{BE@{BE@{B{B EEP;gY}EE^_Ð8wB^_Ð=bBt bB^_Ðh!pAh{B2{B^_Ðh)pAh{B2{B^_Ð3EEPfY}t1Et(E EPofY}t Eu3^_ÐE@ P0YiEE@P0Yk<EE@P0YEPh.pAh{B1 {B^_Ð5 @h2pAh{B1 {B^_Ð5t@h5pAh{B~1 {B^_Ð~Ph9pAh{BZ1 {B^_ÐrA^_Ð%sA$sA^_5(sAh=pAh{B1 {B^_ÐTE}}*h@pAh{B0+juh{B1 uhHpAh{B0 {B^_Ð=Au3PhLpAh{B0 {B^_ÐEbBE^_ÐOpA^_ÐPA@BE}uEXpAE^_5hcBhYpAh{B.0 {B^_Ð5lcBh]pAh{B 0 {B^_ÐapA^_Ð5AhfpAh{B/ {B^_ÐEP dY}t EtE0{B=@tlpAnpAPh{B/{B^_á,BA<uhppAA,BЃ:uhwpAh{BEPEPE4v  E=(uE ƋUtEFEE=|}|*EE8t =(uE=)uEE@P%YEċuhTqAhHqAj}u^AE[^_ÐEEE|EEY=(uE=)uMuEE8=,u}uEEWT}tEGNjU҈ujEPhUqAj}=@t-EuEthqAjEE9E|uEPEP E؃}tEEԋU؊E؄҈uyAdhrAhDyARhqAhIyA@5cBhPyAEP EPEPEPE =~SuEPDE.uhXyAEP xcBU4EP,EcB9E|E;k8sA=zAj}}EËUEPh\zAhRzAjE= |= ~YEPSh]zAje@̍B@ t7}~1E 9E})hmzAhYËUBU MEH4SY[^_Ð;= t;= t;uOWhzAhzAjGÊUGjShzAjE HE =}BhhzAS$YuB=5x @>Y3[^_ÐE@;vLF=;t F=#u6F= t F= u jhzAhzAjE AFUE҈GE@;auEYStY3[^_ÐNE ;ur= t= tFFUFm juhzAj}U(WVS],]@ =Aut@PLY=At/hlBWbYEAuhlBh1{AjAE5PAhW{AhB{Ajuhn{AhX{Aj5@h{Aho{Aj5Ah{Ah{AjSh{Ah{AjL@`B`BH{BةA5@jGlB5{Bh(}AaAj5{Bh6}Aj =Au=@} hM}AлY=qAtJ=AuA5{BgYE@PYE܃}t-5{Bu?EEHET5x @!~Aj u:50 @5p@hF~A% hR~A Yhn~A Yh~A Y_ÐU WVSu ]VjYEt}} [^_Ð3qVk 4 tCuVk 4 u3Et#uVÍWk 4 t[^_Ð}t [^_GEH;|uVËUJk 4 u EH[^_Ð[^_ÐUWVS]u jYt}} [^_Ð35k 4D Y;u"Vu k 48 u [^_ÐG;}|Ƹ[^_UWVSu E3S4h~AjL]G4YWh~Ah~Aj$Sh~Ah~Ajuuh~Aj}} [^_ÐE@PYE}u0uhAjuhAj[^_ÐE34uG8uuYSuh2Ajb;]uuu?&jheAhMAj5hfA]YuY[^_ÐU$WVSuVYEPVhAj} uEuhAhAu UYEPu hAj}}=\uF=%`V:YFEn}} E:E@PWYE}uhAkY[^_Ðu u}t juhA jhAhAjE=0|s=9l=PA}+UȈB5PAhAhAjkPA(BUM0 5PAh AhAj{TE=!|t=~mEYBtEPZ1YEEUȈBjh/Ah!Aj%3[^_Ð=&EPEPV, } [^_Ðuu1.} [^_VYm`E,BEu [^_Ð}~:E@PYEuVh0A[^_u uEE܋UM 3[^_ÐjVhJAj9VheY5 AV5B5 =~VY5 AVh[Aj3G}&Bk <tBk 4VWсu!WhAhmAj[^_ÐWVhAjBk <tb AVBSk Bk  BSk DBk D BSk fDBk fD K;E@PYE}uVhA-[^_ÐVusBk M }~\E@PYE}u8VhABk 4DYBk [^_u uEBk MLBk fD A[^_ÐUWVSuu(jSh׀AjSYjVh̀Aj=\uF=%FE=PA~FE=0|;=94kPA(BU0kPA(BU0$E=!|7=~0ȈBȈB,jhAhAj93[^_Ð=&EPEPV(( } [^_Ðm`E,BEu [^_ÐEB9E~ [^_ÐEU<t4j4hAjEU4@YEUjhAhAjm5 AV5B E}uVh!Aj>E[^_ÐBkU <tBkU 4YBkU |tBkU tY}XBWk Bk  BWk DBk D BWk fDBk fD G;= A| ABk A Bk A DBk A fD3[^_UW A32Bk Bk DBk fDG|3&B3k(DŽBA |G2|3ȈBG~|3,BBG;|_ÐU=A}$A@PAsA,BЃ:uo=@~V@<0Bt"@40BY@0B@ @4̍B]Y A@A,BЃ:=PA5PAPA4Bh.AjPAPB=A{BPA@Aj PA=A}&hhЬ^$Zt@Pl2Y=A}3ÐAÐUu'=5x @ $Y3UPE=$sA=@uhNAnY3|B@j=YÐ=@uhjA:Y30|B@j=YÐ=@uhAY3|B@jL=YÐ=@uhAY3d|B@j=YÐ}u  EPBY=} ÐuYPhA5@$YPhAy~hAcY[^_ÐW5{BBk 4 u#Bk tBk 4|F;5 A| G;= A| [^_ÐBk tBk 4x}Аk PAk PA菶YEk PAhBAk PA+k PAt k PA4u E 0uhbAPC؋qA;~4SAH;:-3G;=4SAD<ȈBt?Fu hfAYWhyA5{B" 4ȈB5{Bf|G~|hAYkPA(BtkPA(BWhAw G |v<,Bt7u hAMY4Bu@G`PhA' G|#hA YE= }E5@%PhۊAEPhߊAEE8uhAY=At5AhA hAY=AtGA_APh/Ai=At5AhcAMhA;Y5AYPhA#5AYPhA 5Ah܋AA[^_ÐEEPhMAE8uhSAYaEEYBWtEEEE(EPhUAEP EPYEqAH9E|h[AKYECEPh]A4EE8uh`AYUPW=@thbBhA h̍AY3Rk @9Bu?h Ak Bu hAY"k Bh'A GB;|=PBtPh*Aj_ÐU WVSu 3}uh0A<sAuYX7A|}(uG})uO}3},u[uW |[B}h|[Bj,[B,[B |[B}h|[Bj-[B-[BE |[B}h|[BEPu[B[BU} u2 |[B}h|[Bj E+[B [BC؋qAJ;~] |[B}h|[Bj-[B-[B |[B}h|[Bj [B [BsA}*qA-9sA~苏tfsAFEy |[B}h|[Bj h[B [BsA@sAqA;~ %u [^_ÐsA3[^_ÐF= tsA>U5@YPhIA=@5@oYPhYA5@UYPhiA5@;YPhtA5@!YPhAv5@YPhA\5@YPhAB5@YPhˎA(5@YPhێA3ÐUMAt U ;uU ;uÐ3U\ttAttAEYButtA=-=(b=#-= t EÐ=!=%=$tw=&thw=*t\ =)tSb=+tHW=@t<=<t3 =/t*9=>t /=|t =^t =~uttAttAÐttAEYBtE EE}=AuttAPh AqptAttAÐttAEYBtttAP Y ttAUEttAttAEYBuEttAEYBtttAP Y ttA=ht=ot&=qt=tt(=xu.EttAEttAEttAEExtAfE-0E} ~m'E9E|0ptA=AuEPhANÐExtAExtAEEuUWU }3_Ð}}6E؉Et&tMt EEEu_UP|tA=^u-tAE|tA5tAu`tAÐUEtAtAo=tAutAWE=tAtACE=tAtA.E#tAtA-%|= w| $tA|tA=*t.|tA=/t |tA=%t|tA=&tÐ|tAE|tAtAEE냐UPWMI_UÐUWVS} u3ۅ}؋}؋tu[^_ÐC%ׁ t&tt;}u}+t ttu̅tuNj[^_Ð˸[^_ÐU|tAE|tAtAEE=#tZ=+t3=-t<=<tm=>tz=@tG=|u|E tAtAlEtAtA\E+tAtALE3tAtA<5tAutA$E tAࣀtAE tAtA|tAPh,AÐU<ÐU|tA"|tA=Et=Au h4A1YptAtAÐUWptAEttA*|tA||tA=Et=Au h4AYptAtAпBRhWAW =ptAt[A_Ë_ÐU|tA=NuxtAtA|tAÐ|tA=(uB|tA|tA=)tÃ=Au h\A*YptA룃=Au hwA YptAU`|tA=!u |tA5tA}YtAÐUP|tA=-t|tA=~ud|tAE|tA|tA=!u|tA5tAYtA}-u tA tAУtAÐ|tA=!uX|tA5tAYtAU WVS] E=?~ =`}E E=`=zm`E,BtSEBE3<t 4YG;}~E4,BYE,BBtHCP5Yu [^_ÐE4,BB3 G;~3[^_ÐU`WVS]E U3;=]t GSKY;|~ShA[^_jSEP, EˉEE=\uE=&uEE=&tEPhA|[^_ÐE@E=?~E=[}EUR PUE=`|=zE@=[tEPhA[^_ÐE UEpEEE3(=[uE=]uMtEEFG}u=]tEPhA[^_ËEEEEEEEPEPug EP7YuEPhAA[^_ÐEP8YE}/={Bu hFA YEPhHA[^_ËEU3[^_ÐUP}@uE`U`|% <,Bu ÐB9E ~ÐBÐUW}@uE`M`|,Bt B9E ~3_ÐNjU _ÐUWVS}=\uG=%t%=&tVhA[^_ÐWSY=}VhA[^_Ð=%uGthAY[^_Ð=&u&G=[tVhA[^_Ð=%u2GEYBt E E[^_Ð=&urEPEPW }VhA[^_Ðuu}h8AY[^_ÐE UEU[^_Ð[^_ÐU EEEEPEPu蕪 |EEP4Yu ÐuuYU 3ÐUEPu}Ã}t E EE )EuhgAEPX EPuEU3ÐUWVS}}u 3EPhwAhjAj艖ljEE33EGtuUAE 9E5E}t$E@0qBuhpB EUM u= t= t={uuu GEECQ=}u2Ku}t E/}( u}= t = uܸ;= t= 33ۋE 9Et(E}tWE@0qBuhpBF}uV;~ME}t8E@0qBuhpB'EUM GE]EUM }tPAUBdB[^_ÐUPWVu5PAhAhxAj耔PA@PA=2~35PAhAhAjT PAhAvY3^_ÐPABk T PBPABk T B5PAPA4PBhAjA=AR~25AhӑAhAj迓 AhԑAY3^_ÐDBAHBA{BAJ{B ALBAJLB A{BAJ{B A{BAJ{B A{BAJ{B A,BA,BA PALPABjBk 4hAj蚒Bk 4h ArpB%rBG0qBhpBYG |jj u ^_ÐUWVS3EE 8A= t={3۾GAA= ttAEGUE҈uOtAE={uF=(uC=)uK=}uNu)GGAI=,u.u*)G,GGUE҈uOAA= tIGA9u GA҈uOEE 8t [^_Ð3[^_ÐU5qAEP58sAhA |;uhBAYu5{BN{BE}uYuAuY A=@uPhlAAÐUu_=5x @Y3轏=AthAYAAÐUPW}u tA_uqY@tA=@(~ @HO9tA~uhpAǣtA_ÐuhuA_ÐUPWVS} u]uAuAxFEEYBtEPKYEGEEYBtEP&YEEU;} [^_EU;~ [^_ÐKu3[^_ÐUWV}VjhAhAhAB A}"=AhAY^_Ð5A5{B{B{BhAhA5AA A-EOAj gY=}hA:Y3^_Ð{B@Ah5Aj A5A5AhAj轍=A}%j B Y5{BfYA3^_Ð5A5{Bk}3A5A5{BhʕAjNA^_Ð5qAhAVuGAVAPh֕A A} A^_ÐjPhA5A,YPY6ut@PYj5x @MYA6=Au-hYAY5x @!YA=At 5qAbYVu85qAhXAhWA5AhA A=A}zgjYA=A~]hsA0YA%EEEP5{BA5A5{BhvAj躋hAQY A=A}3A^_Ð5xl@xl@+Aj+Y9jhAhAhA A5A5AhAj&=At5A3+Y5xl@6u hA.Y=A}hAYA^_ÐAu-hAgY5{BYA^_Ð5A5{BA5A5{BhAjohAYUjhAhAhAA} =AhARYÐA=\tE\j5AE j5AEP hAhAEP A|65qAhAj hږAhЖAA|A}AÃ}9u 3AhA5A5AEP/} EPhܖAsA3ÐAÐUWVuYtXu5qAhAhAhAjhAh4AhAnA=A}!=Ah5AY^_5A5AhNAj茈5AEP}E=\uE=%t=&uG=%t=&rhAhAW& At5AhbAh\Aj=AugjhAhzAhcAA+5A'YAjWh{Aj赇j5AhAj螇u=AfhAhA5A A=A`uhAY^_Ð5A5A} ^_ÐjhAhٗAhAA|TjWhڗAjj5AhAj؆jhAhAhA~A} A^_ÐjWhAj葆j5Ah AjzA={uGA5AYA=A~'AAJ=}uAAJAuWYA^_Ã7tXu2E {B{BEPh{B5A {BA5ANYP5Ah0Aj衅5AW肻A=A}57tXuKARAPh?AA3^_ÐXtYu ^_ÐA^_ÐU4WVSu EE}vnuYE=W3GCPheAhYAjÄVY4E9E$u 9Euuu =\ @u1=@u(}tEAPu5$ BhA|}u A[^_Ã}tTE==tGucYE E}~*uY}uhA gX@}t5E==t(EPjuh>A("E=~E\@E[^_ÐC3[^_ÐVh 5{B uHtЃ=\ @u=@u5$ BuhfAt juhuAj+3[^_Ð5{BY{BW~{BW=!|W5{BhAj؂EEEEEEPj5{B }u%YE=UW}SuG A} A_Ð=AtAAGhטAcY_Ð}(V=$ Bt$ B8t EA EA5qAhAh.AuA} A_Ð=At5AMYuh/AھY_Ã=4 BtS54 B5A^E}t6uY=}5AhSA苾_ÐEA=At 5AڽY5A蹾Y@P%YA=At5A5A茾=\@\@5AYA=\@A_Ð_UP5qAhAhAhAA}=At AÐj5AhAjlh5A5{B oA} AÐ{BA{B{BhAYu,@5ARhA5{Bqj5{BhAj5{B]$YAÐU}@u3AE =3+$AAl@h@d@`@\@A@@|@x@t@A@Ap@A@@A@A\@A`@Ad@vAh@jAl@^Ap@RAt@FAx@:A|@.A@"A@A@ A@ÐÐUP5qAhAhAhҙAhAA}%=AuhәAOYÐAÐh5A5{B蚻 j5{BhAj}5{B5$@hA5{B7j5{Bh Aj}A}AÐ{BA5{B"Y5{BY=u3A=At)=At$A%AP5AhA[ AUDBA<uh*A3YÐHBA<uK=PA =@~ ^5x @QYhCAY=At<5qAY.jhAh[AhEAJA} AÐ3UWjhAhjAh\AA}#=AhkA]Y_ÐhAhA5A A{B{BhA5{Bq5{BhY{B={BA=\uA{B{BAA҈u {B{B {B5qAEPj hAhAoA{BA5AӸY=}({B{BAA҈u {B{B {B5qAEPj hAhAA{BA5ARY=} {B{BAA҈u {B{B {B5qAEPj hAhAjA}=A_ÐuhA5{B蠷 {BA5A覷Y=}h9A0Y_Ð{B{BAA҈u {B{B {B}}{B<{B{B>{B{B {BjhAhʚAhA:A} A_Ð5AY=h{BhA}h˚AZY3_Ð}uhAAY3_Ð5 AhA5B& A=A}QhqAhAZ5 Ah A5B A}hAԵYA3_Ðj5{Bh-AjxxW5AA_ÐU5t@50 @5p@hRAr=x@t5x@hgAVhkAIYhA>Yh˛A3YhA(YhAYh&AYhGAYhiAYhAYhɜAYhܜA۴YhAдYhbAŴYUPW}>u'5qAhAj hAhAoAQu'5qAhAj hϝAhACA%5qAhAj hAhѝAA=A=A} A=t=>t=]A}OEA5qAhAhA5Ah|AA=At=A}0A_Ã]5AYA_ÐA A뉐_cAui>uM=AtDsE}}A3_ÐE#A;AuA_ÐjYA Au>u A=Au3A3_U5qAhAhAhAhAA}"=Ah AxYÐ=Ath*AZYÐ5A5{B蟲5{B薲Y{BЍRA5qAhAhSAhJAMA}%=AuhTAYÐAÐ5A5A#A} AÐj5{BhqAj`tj5AhAjIt5A5{B}"5A5{BhAM ÐAÐU=PA}!5PAhAA3á{B{BE EPh{Bu =~{BEjuhAjs5PAhݞAh͞ADjPAHk(BhAjOsjUQ Y迱躱5PAh AhAj#s=PAPAHk(BA,BЃ:urjhޞAPAHk(Bl RjhAPAHk(BF ,jhAPAHk(B 5PAhAh AjVruYE}E@P>YEPA@5A YP5{Bܩ{BT@uhA`Y_Ð5{B让Y{BB{BX@FAh5{B} _.{B= 5qAhA5T@hGA!o=AA,BЃ:{BEhua}hNAuY_Ð5qAhAhAhAAuhA(Y_Ð5A YP5{Bd{BT@5{BQY{B@{B +HEX@Au5{B蕋={B= 5{BY{BW= u {BW{BEEEPEP5{BN} {B8tYPhA5{BujhAhAhAS5A5{BM{BX@3tjPhAphA/Y5x @Y=AtE5qAeY75qAhT@hAhڡAW5T@hAj.itƅ}&u h7AFY3hAY_ÐT@uhAYhAY3_Ð5T@YP5{BP{BT@hAIY5x @-Y=At-5qAY5qAhX@h6Ah&At܅0gthAYugj5T@hDAjhh,5T@h8wB詥 h,h8wBhPAjgL@r=@t@*5X@TYE}~X@UJ=/t5X@Ytij5X@h\AjygAtL5X@}Y5X@hAyAX@A_Ð_ÐhAGYX@ĢAA_ÐUWV}A} A^_ÐTu5PAhբAhŢAUu[5PAhAh֢Ajf=PA5AhAhAjufE%E0EE,^_ÐE@0EETul=PAuEȈBPA-k(BUuuhAhA uVh AjeVEPÛUu3-PAPA@k(BU4tuVhAA3^_uhIAh.AjpePA@k(BU4EP=PAhhЬE} uhiAhXAje5PAhAhjAjd^_ÐU\WVSu hAhAjd5AhAhAjd5PAhAhAjd5@hAhAj}djuhAjiduY؋E=:t1]EUJUM M}E:SSuhʣAj dE@=.tE@= t E@u$uhA A3[^_Ð=AhAޠYA3[^_ÐA,BЃ:uW} /uPABPAPBVY+@EPVh.Aj;cEEfA,BЃ:?E} /@4̍BY@4̍Bh 5{BP 5{BF= t= t=:ua5{B3&{B=!} {B{BG{B8u;~PuV u E@̍B@ 5}u;5AhAhAjalu uhA3[^_ÐE[^_Ã=A'uhӤA3[^_=,uE}t= =:}uEE3-G=2.E=!|!E=,tEEEU҈uȋESuhAjZu5{BhPAjZ{BA<t$5{B5{BVhoAhbA19u~EP5{B5{B VhAhpAjZB=t= t= u~u |3xB5qAEPhAhAOuhAؖY^_ÐVhAhAj~Y{B{Bu5{Bj5{BhAjLYjhͦA5{B u{BAEtjhӦA5{B u t@EPjhۦA5{Bf uPAdBE%5{BmY5{BYE5qAEPhAhA(E}uhA试Y^_Ã}vuY=5{BY{Bƍ@{Bu5{B軕j5{BhAjXjh A5{B{ u{BAEtjh&A5{BN u t@EPjh.A5{B* uPAdBE%5{B1Y5{B趓YE5Bh>Ah3AjVWE9E} =B t"E9Eu =BtE9E~=B u3uhIAh?AjWuhTAhJAjVWh^AhUAjVxB5qAEPhyAh_ACuhzA̓Y^_Ð}^_ÐVuhAjpV{B{Bu5{Bj5{BhAj>V5{BYWhAhAjVxB$5qAEPEPhŧAhA|Ae}_Ð}_ËE8_ÐUW}WhAhAjMuhA躊Y_Ãu35{B={Bu߳AAPhʳA腊 _Ð|3}~"E9E ~uhAZ_Ð7}_ËEU _U}uhAYÐ}|2} ~ } tu hAÐE}EÐEU ÐUPW5qAhAh2Au 7}_Ð5AYAE8t0YE5AĉY~$GP(YU5AE0虉 EA_ÐU5qAh4Ah3A5AhAE|A[|A= 1)$ЮAh BYÐh5Ah( BhXAh0 B5qAhAhAh}AxA=xA}=xAtxAÐ5A誈YxA|A=xA~CA={u4AxAJ=}uAxAJA-|A=|AxAxh BYÐ5qAhxAj hJAh&A耶|Ah'5|A5xAh Bh B:YÐh B*Y|Azh B YÐh BYÐ5qAhxAhAhkAhLAm|A}9=|Aun=$ Bt 5$ B^Y$ BAÃ=xAthlA趆YÐ5A5{B|A} |AÐ=$ Bt 5$ BY=4 Bt54 B蚅Y4 B{BA=ARAC5A耆Y@PY$ BuA3Ð5A5$ BGhA5$ B54 B5$ BYAÐhA蛅YÐAxA=%uxA@A=suxA|A9xA||A9xAuj%hA5Ð=, Bt5, B莄Y, B=|A~&|A@P̈́Y, B5A5, B=AÐUP}tN5qAhAhA5Ah|A|A}R=|AhA|YÐ5qAhAh޵A5=Ahx=A|AV|A=$A5qAhAj hAhA|A =At=AthAكY3Ð|A=Au @ @=Au  @A5qAh?Ah#A5AhAxA5qAhAAh@AjhxA||A2|AAA=xAB{BhMA聂YA=Au ARA5AY=} AZA5A5{B)=}$5AhbA}A3Ð{BxAAAÐ5qAhAhAjhAxxAA} AÐ}tJ+xAPhA5{B% hA5{BhAjS)L@L@ÐxA@AÐjhA5{BɁ 5qAhAj 5{BhA>|Ah=xA}tB5AhĶA5{Bk h˶A5{BhǶAjS^(L@L@ÐA@AÐ5qAhAh̶A}t ԩAAP}tAAPxAEx|AxA@}5xAhAEP蚀 hAEPhAjS'L@L@Ð5qAh AhA5xAh$AXxA|A} |AÐxA@}tD5@hA5{B hA5{BhAjS&L@L@Ð=@u @=@@h@YxA}xAÐ=@@uj jÐhA YÐU5qAh5Ah4A5AhȫA-|A|A=)!$DA5qAhxAj hWAh6Al|At=xAt#=xAthYAe~YA3Ð?|A6=xAu @=xAu @Ahd@YÐh|@YÐ5qAhAhtA5@?Ah?AxA|AxAp@AÐ5qAhAhAjh AxA|jK|A|FxAAAÐ5qAhɷAhAjh8Ah|A}|AÐxA} xAÐ=0sAt=4sAtA3á|A4sAAÐ@xAh@dY|AøÐU} uhʷAhA5{B|} tO5qAhA5{B5AhA莿|A}S=|AhA|YÐ5qAh,A5{B5|AhA?|A|A=Y==K=5qAhxAj hAhqA\|A5|A5xAhA6 |AA=A~hA@{YÐ} uA@A@@ A@|AAÐ5qAhxAj hAhA輩|A} B5@5|A5xAhA|A=A }hAzYÐ} tN{B{B5AhA5{Bz h A5{BhAjS!L@L@Ð=A@#~ A@#5Am|A} |AÐxA} xAÐ} u+|A@+|A@ÐU5qAh׺AhֺA5 Ah̪A|A|A=$A5qAhAh'AhغAڳ|A=|A5AsY=2~j2h(As5AhAXsA5qAhxAj huAhJA褡|Aj5|A5xAhA|AAAAÐhA:YÐhA*YÐ5qAhxAj hAhwA|Aj5|A5xAhA<|A|wAAAÐhAYÐ5qAhxAj h AhA訠|Ah5|A5xAhA|A} |AÐAAAÐÐU=At5t@eYPh ANqU\WVSU}[^_Ðu_5qAhNAhMA5AhA[E}!}hOApY[^_Ðju&[^_ÐH=$A5qAEPhAhiA#VuhAj>3E]jShAj%3hASujCL@3H5qAEPhAhA诰}<hApY[^_Ã=@tjEu8L@5qAEPhAh׼AC=@tĔhAhAujDL@zShAhAhAjHL@3E5qAhT@hAhA誯<5T@coY=} hAnY[^_ccL@5qAhT@hXAh>A65T@nY=}hYApnY[^_økL@\5qAEPhAhzA蓬UunY@PmYEuhAnY[^_ÐuuIn5qAEPhAhA1unY@PmYEuhAmY[^_Ðuum5qAEPhؽAhA} umY@P mYEuhٽA6mY[^_Ðuu}muuujI^L@}t unlY}t u_lY}t uPlY3跷hAhAhAjIL@3=@t =@uhAylY[^_ÐT@AX@A5qAEPEPh>AhA蛞}\h?A lY[^_u5{BflH{B5qAEPhAh`Aw uhH{B)lhH{B!lY=^~hAkY[^_ÐH@{BT@`BL@s=@@5qAEPhAhAӫehAhAujUrL@5qAEPhھAhA胫u?kY=}h۾AjY[^_ÐGjTu L@5qAEPhAhAhAhAujWL@]3lh AhAhAjAwL@3%5qAh"Ah!A5 AhܩA@EjEPh8Ah#AaةA$]@ Y@(]@ Y@E%EEuEPh9AjVL@{jEPhPAh;A跧E} E[^_ÐuEPi5qAEPhpAhQA謩|BuEPhqAjVPL@=@t[^_Ðó} [^_Ð5{BhsAh[^_ÐUEuhAhY3ÐE PuhAj@+hAhAuE PÐUP5qAhȿAhA5\AhA||A}|AÐ=|AEPYA,}thɿAgYËE@@@@@@@@@@@@@@@@AÐ=|At =|Au~YxA=|Au3@}t;hA=@t AAPhAjSjL@L@ÐAÐ5qAhAhAjh>A$A}AÐ諱xA} xAÐ|A-=$A}t:hA=AtAAPhAjS L@L@ÐA@@_}t:hA=AtAAPhAjSJ L@L@ÐA@@}t:h A=AtA APhAjS L@L@ÐA@@}t:hA=AtAAPh AjS L@L@ÐA@@W}t:hA=AtAAPhAjSB L@L@ÐA@@}t:h'A=At#A%APhAjS L@L@ÐA@@}t:h0A=At,A.APh(AjS L@L@ÐA@@R}t:h9A=At5A7APh1AjS> L@L@ÐA@@Ðh:AcYÐU5qAhKAhJA5Ah`A٦|A} |AÐ|A=tl$Ah6AjsGPhGAh?AjZ5H@hPAhHAj@5`@hYAhQAj&Nj`@PhbAhZAj5@hkAhcAj5@htAhlAj5l@h}AhuAj5x@hAh~Aj5@hAhAj5@hAhAji_ÐU}uEA} uE Au uhAh8wBYh8wBYÐUW}uAWjjj jWhAjjWhAj$@ Pj_ÐUPWuLYY^~ E E W uE @PYE @_ÐUWV=AuhA#jXYAu hA-Y=AGU} uE A}uEA}uEAE t:Wu >Et#Vu'Et VuAT@j5T@hAjg^_ÐUWVS=At 5A1WYuXY@P}WYA=AujhAhAjN3[^_h,uh8wBW EEA3EE= tE= tuWYEEUJM}EUJ= t֋EUJ= tCUECUEE= t Eu^C4BW4BhAjOGEuqWh AhAj0B AtcBB[^_ÐCUEE=\nEPYE=>)EE= tUPAeEt ~Ae} }^AAU@}u ^A?AAUAÐU4EEP3Y=~u EPuU Eu%hATYE}tu uuU EU JÐUWhAUYjjYE=Yt_6=Nt?!= tM = tDW= t8K=Qt?=qt =nu,h#ATY3(=yuhATYh&AoTYY_Uuh`AhHAjj裕Yj蛕Y0sA= At3jhrAhaAjhsAjjjUhtAhzASY訑jhcBlÐUWEPLY}u A_ÐE8t# NjU:AG|AA_ÐUPuhAhAj,=@uDhAKSY 9,]@u(5qAxY={Bu5{BhASÐh|[BSRY5@EYE}} hARYhhЬ5zjhAhAj,]@=tp= 5AhAhAjVt@PY=AW5qA,xY={B>5{BhACRÐt@PnYjhAhAjÐjh)AhAjt@PxYÐU WVA=@tE=,$$A^_u RYEuRYUЍR,~h*AWQuuu hAAWQhAj=}@^_uhKAW}Q hAj d@^_ÐuiQYE0= uE0F=,~hPAWQuhaAW Q hfAj藕@^_ÐuPYE0= uE0F=,~hgAWPuuhxAWPhAj y@^_Ðu jSu aPY@=,~hAW-Puu hAWPhAj褔@^_ÐuPYE0= uE0u OYƍ@=,~hAWOuu hAWOhAj y@^_Ðu}OYE0= uE0u ]OYƍ@=,~hAW'Ouuu hAW OhAj虓@^_uhAWN hAjcSUWVS=@ =@LWhAhAjj荇Y%=LR=K=j=g=XhAjjj hAjjj h Ajjj =0= -= = =A3====E=B{=F==l=at(=X u=RE=At=At=At 3[^_ÐA=Au AhAjjj shAjjj `=@t4@H|=w | $$Ah1Ajjj (h8Ajjj h=A5PcBjj=bBthJA5bBjjhPA5hcBjj=bB~,hcBD@kd=bBEhcAujj=$@u!hqAjjj qhAjjj hA5$@jjLhA5H@jj5hA50@jjhA5@jj=@uhA5X@jj=,]@uhA5@jj+=,]@t =,]@uhA5@jjhA5@jjA3[^_Ð A3[^_Ð=Z=et=b[^_Ð=ftM=xt=_=rh Ajjj @@5 tB4 Y[^_ÐhAjjj (@3[^_=zu%hAjjj ,@3[^_Ðj Y3[^_ÐUP=@t =@tÐ=@t=@t9E~ÐEׁ=@u}t=@}5t@YPh2AEPH EPjjj hZAjjj hAjjj hAjjj hAjjj ÐhAjjj pÐU4AAAAAhA蹀Y=,]@uhAMY=,]@u hA5Yh8A*Y=At hAYhAcY8AA=bB~/5bBhAh8AG h8AY8AhAY=@t\@H|D=w=|9$Ah,AY>h4AY.h:AYhKAYhRAY9Au hWAYhwAY4AAU@W=4At[=hcB=A4zEЃ=,]@u(@$@@Eă=,]@u =D@=,]@u=M@EEuC=bBt"=bBc~bBdȋǙ _Ð3Ẽ}d~EdEd}d} lcBlcBE}~ E}3EȀ}t }u}ȃ}~"uuuWj hAEPEuuWj hAEPEEP}YA_Ð+A=5=Aǹ+AEE;AA=M~hA}YAj.}YAEE9E|_ÐUXWVSu=@t<\ @jjY=\ @u%t!t@PyYhhЬk tF ;t==@t-=@u$=\ @u=At=@t=@u[^_Ð=AuuuE PV [^_ÐuEDYH=$AjPuh8AD 4A[^_ÐjPuhAC [^_ÐjPuh8AC [^_ÐE =$AjZYAA=N~ hA|YhA{YA9AjZN{YA[^_ÐA A=N~ hA{YhA{YA[^_ÐAA=N~ hAh{YhA]{YA[^_ÐA A=N~ hA,{YhAzYA[^_ÐhA{YhAzYuzYA[^_ÐhAzYhAszYuzYA[^_ÐA A=N~ h AzYh AzYA[^_ÐhAjzYA[^_ÐE =YN=DujY[^_ÐAA=M~h@AzYAE =Zu9AE P_yY[^_ÐjQyYhAAyY[^_hBAyYj?.yYuyYA[^_ÐhCAyYuyYA[^_ÐAǣA=M~hDA[yY=AuxY[^_ÐhEA:yYuxYǣA[^_áAǣA=M~hFAyY=AuxY[^_ÐuuhGAEP;@EPxYA[^_hOAxYA[^_ÐUjuhwAjt=@tujjj juh}AjÐUP=@t0|B@j賀Y=@t|B@j葀Y=@t/jhAhAj$d|B@jYYj QYj IY=4 Bt 54 B>Y= AtP5 AhA5B4 E}|.BkU hAul=~j'YjPY=@t54 @hbB>< @@vFUuhAhAju hAhAj} tE E=@t0uhAhAj|B@j&YunYÐUhhЬeU=@}=\ @u =@t3A=Au#=At=@u AÐ3AUW=@u(@=PAu#hY5xBY[^_jj5xB hAYAA5xBY5xBY[^_Ðjj5xB1 hAxY5xBY5xBlY[^_ÐE=@~kA =@ AEjj 5xB uhA 5xBCYjj5xB =X@c~9=X@"t-=@u$X@dkEd@ E5A5AhA }~uhAz5xBYjj 5xB 5@YPh/AB5xB|Yjj5xB 5xB^Yjj5xB 5xB@Y5xBYާAdAAAAA|Aji^Y A[^_Ðjj5xB% uhGAij/^YAA5xBY5xB?Y[^_Ðjj5xB uhLA 5xBGY5xBY[^_Ð5xB)Yjj5xB} 5xB Yjj5xB_ 5xBY5xBYAdAAAAAO A|A[^_Ðjj5xB u"Y5xB^Y5xBY[^_jj5xB hOAY5xB$Y5xBY[^_ÐUPT@AX@A @B5|cBxcB0hAj=|cBxcB=-xcB@=-=D@uxcBpjY |cBxcBxcB5|cBxcB0hAj0xcB==u3áxcB=-u+xcB@EPY}$jjhAxcB0k |cBl5BhAhAj=@u=Bct = @t hAaYX@=Bst=Brt=Bvt hA,Y=Brt =BvuS5X@jY} hAY5X@Yt(5X@nYuh:AY X@WA=Bvu)=@t =@uj!Yt hXAY=Bst=Bvt=Brt =Bxu0=@t @=@t@@=@t @BÐUWVSxcB@5|cBWhAjxcB |cB=|cB|xcB=-u hAYxcBH@Qt hAYxcB |cB=|cB|xcB=-u hAnYxcB0YE}~Ex@hA>YT@=Bt hAYBx=Bt h AYhAhAhAjFzBi=Bt h AYBvE=Bt h4AY@Bv=Bt hHAaYt h\APYEH@xcB@tcBV=Bt hAYt hAYxcB |cBtxcB=-u h'AYxcBT@Br] @M$@==T@*jjt h?AnYxcB |cB=|cB|xcB=-u hbA2Tt UjThAhAjWhAhAj5PAhAhAjWrYEPhAhAj5PAh0AhAjE_Ð5t6t Etgu WJY_ÐQuaXA!# a_Ðu5qAhGAh4A5,AhAYXA"Fa\A!XAt h;3\AXA-XA*u/jhdAhaAhLAVXAY"\"uo5qAhAhbAjhAYXA}=XA"j+YA_Ðw`\AD 5XAYA_ÐuGA_Ð\u~A_Ð5qAhAhA5Ah0AcXXA=XAuhAY_Ð=XA_!_\A5XAY\A=\Au3A_Ð;t9u WMY_Ãh5qAhdAhAhATXA 5dA28YE}uEAE8tuhA)j uhB E&t7t XtYu WMY_ÐGjhdAhAhA%R\A}!=\ArhAY_Ðh`AhXA5dAc: \A9Z^\A'5`AXAP59h A5YA3_ÃSt(u WhSY_Ãu=0sAt =4sA`W_Ðu T_ÐAj5dAqrYdAj5dAhGAjXA\A t >t]u WZY_Ð5qAh\AhdAh}AhoAAXA} =XAh~AJY_Ã=\AthA.Y_5dA5{Bs5qAhdAhAhAOXAf5{B5dA%m3u3YXA-5(@uYA_Ðt uq5qAhXAj hAhAB=\A}=\A@XA.Y\Aj貢Yj5XAOu0XXAz%3\@L@a3_Ð uKXXAEhAhAhAjFL@=@2Hu S_Ð u[5qAhT@h*AhAMXA=XA=XA5T@oYT@bXA_ÐVuW AYA_Ã5qAhAhY_Ã=\AthlA"Y_5dA5{BgH\A=0sAt =4sA5A5{BhAjAP5{BEA_Ð&5qAh\AhdAhAhA/XA} =XA hAVY_Ã=\AthA:Y_hAYEu4@E5dAuhA5{BDG\Aj5{BhAj蠿5{BdYA_Ð4G\A_5PA5@5AhAz=PA}h#AhA_3_ÐPA4dB5PAh`A9 \A ?uw G\A5t@50 @5p@hA=x@t5x@hA hAYh|@+eYA_Ã'5qAhdAhAhA<\A?hA YEu@@E}uY5dAuhA5{Bn5{BqbYAt a5qAhAhA5AhA2>XA}=XAIhAY95qAhdAhAhA2;\AX5dA ]YdAXA=w | $4A_\A.\A"\A\A \A 5\A3AY^XAhAY=XAu5dAhAh[B8 5dAhA=Au+=XAuhAh[BhAYA_Ð5dA5\AC>XA=XAhAAYWh5Ah'Aj_ÐXAƀrAXA=XA|ArA=\Au3A_Ðk\A Bk \A  Bk\A \ABk\A Bk \A T B\A A9\A|5qAhAhA5 AhB;XA}"=XAhA0Y_Ð5qAhdAhAhA8\A5dA5XA&=_Ð=XAdAXA=BtndAXA=btXdAXA=LtBdAXA=lt,dAXA=NtdAXA=nun=XAudAXAJ=\t9=XA~EdAXAJ=\u.dAXA=\t{B\A\A\dAXA{B \A XA\AdAXA<{B\A\Aj5{BhPAj6{B\A@dA5{BY +JXA5XAheAhYAjhXAhdA5{B }A3_Ð{B\A@dAj5dAhfAj蛸5dAIYA_á\A<,Bt"\A4,BY\A,B\A=\A|duE\A5qAhdAhAhA5\A} \A_Ð5dAWYdA5dAuY@PY,BuhAY_Ð5dA5,B70Btduh,B5XA$*j5dAh3Ajd5dA5XA舭ALBA<tP=AuG=At9=Au0u h>A=Ydu hPA-Y8u hcAYA_Ð5qAh\AhdAhFAhAQ&XA}m=XAu\=H@tcBBX@AH@sB@L@s=@t@3_ÐXA_áH@H@{BB{BE2{B 9{BvhjA8Y{B_Ð{B{BdAdA҈uH@HPH@H4BhAj豵=H@u8wBh8wB-YEu!YUB,uh8wBhAh8wBrjPAHk(BhAj/jU1NY5PAhAhAj=PAPAHk(BA,BЃ:urjhAPAHk(BL RjhAPAHk(B& ,jhAPAHk(B 5PAhAhAj6=XAzn5\AhAE\A=\A |XAv5XAhA\AFkXA(B\AdA=dAtdAAPhA\A=\A |XAPA9XA{hAY3_Ð5qAhdAhAhA.E}}E_j5dAhAjdA={uldAEEEPEEE8udAU=}tM}~$dAEEEPEEE8u5dA(Y@PY\A,BuhAY_Ð5dA\A4,B}t\A=\A\A=\A|=@{\Ak\A<,Btȡ\A4,BY\A,B뤐\A<,Bt!5\A\A4,BhAj裱\A=\A|U졤AAE==A="$AE=[uAE=Pt=\~j=`}cAE=_=A=4sAjhzAhpAjɰ0sA=X@~5X@h=B"=t@u }Bt@AP5t@t@5@%PhIBhBYhBY=@t8h|BhB=At BBPhB=@t h BsYh|[BYt@PY}h#BJY,5@hZBhLBj50l@hjBh[Bjۥ5X@hBhkBj5bB5X@VhBhBj莥jYj=@t @@Ph@hbB},hbBhB5A 5AY@5bB5X@}hB.Y5t@hBhBj٤=Au =4sAt3A0sA|AAAhjj5|A5A 5AYA,]@XA5p@hBhlBjhAYPA|thBYjj蟡jjjjjj`A\A}} j/YjEP5A E~5AYAjhBhBj5AhBhBj5xAhBhBjݡ@u YEEEPQYE8u@!E=d@t?}u\A}u\A=\AtM=AtEPY؃=A5=4sA(=A=Au,=0sAu#jY=@j Y5Yj6Y5HBjC5LBj3hKBY= Bt"y B8t5 BhZBh BHN=C;$TB=l Buh_BY%=l BuhBvY hBgY=p B t=p Bt =p Buj Y BjhBhBjhBYjhBhBjʎ=p B t=p Bt =p Buj Y B _hBY$B8hBY$BEhBYjh2Bh-BjF B=$Bt 5$BY$B=(Bt 5(BY(B=,Bt 5,BY,B= B}  Bb3ÐEEYBWt2 |[B}h|[BEP[B[BUEE8uh BYh BYj5$Bh BjI= B BcUWVSE=B@p B Bl BPB=p B}/=@t hkBhBY B3[^_Ã=@uhBY B3[^_Ð=@u;=X@}2hBhbBthBY B3[^_juhBj3j=0 Bt 0 B&BPhBj h Y$Bu#uh'B B3[^_Ð$Bhh>Bh*Bj貋=(BuohY(BuBuh?B B=$Bt 5$BY$B3[^_ÐhhVBhBBj:h:Y,Bu_uhWBK B=$Bt 5$BY$B=(Bt 5(BY(B3[^_hhnBhZBj變=0 B0 B850 BYE50 BYUЁ~phoBY=$Bt 5$BY$B=(Bt 5(BY(B=,Bt 5,BY,B3[^_Ðu=0 Bt0 BBPhB5,BI,BEjuhBj貉j5p Bh@hbB<ẺEhbBY= }1hbBhBu *hbBhBu hBuEPY B=$B5\@j5X@ j+Yj5p Bh@hbBs}4ẺEhbBQY= PhBuc5\@j5X@ }Rh BhbBt#B5$B uhG#B5$B=lB B$hQ#B5$BhZ#B5$Bm"h_#B5$B: hj#B5$Bkg"ht#B5$BPlB Bh#B5$BD!h#B5$B!h#B5$Br"h#B5$B{h#B5$B\h#B5$Bt=BErh#B5$BT h#B5$B9t.lB Bh#B5$BZh#B5$Bh#B5$Bt&h#B5$BJ BLh#B5$Bt%h#B5$B  B h$B5$B`t%h$B5$B Bh$B5$B$t%h$B5$B Bh'$B5$Bt%h*$B5$BY B[h8$B5$Bt%h;$B5$B BhI$B5$Bpt%hL$B5$B Bhf$B5$B4t%hi$B5$B西 Bh$B5$Bt!h$B5$Bi Bnh$B5$Bt!h$B5$B1 B6h$B5$Bth$B5$B BlBh$B5$BDt-h$B5$B赾 BlBeh$B5$Bt-h$B5$Bq BlB!=BlBh$B5$BlBhh$Bh%B5$B߽ulB Buh%B5$B诽ulB BEh%B5$Bth %B5$BhulB Bh %B5$BtlB B h%B5$BTh%B5$Bm!h&%B5$BRh,%B5$B73h6%B5$BhC%B5$BJ hK%B5$B hS%B5$BV = B=@$Bh&B5$B|h&B5$Ba-h#&B5$BF h+&B5$B$Ph3&B5$B M h?&B5$BhG&B5$BhP&B5$BhW&B5$Bhb&B5$B|,hp&B5$Bah&B5$BFh&B5$B+h&B5$Bh&B5$Bh&B5$B# h&B5$Bh&B5$Bh&B5$BNh&B5$Bg3h&B5$BL lB B| h&B5$B@h'B5$Bh'B5$B' -h'B5$Bh'B5$Bmh"'B5$B!h.'B5$Bkh<'B5$BPhC'B5$B5~ \= Bt h'B:YlB B= Bt h'B YlB B= Bt h(BڷYlB Bh>YlB= Bt h!(B获YlB BS= Bt h3(B^YlB B#= Bt h>(B.YlB Bh` YlBhvYlBh%ZYlBh@8>YlBhK"YlBfhYlBJhYlB.h,YlBh"YlBlBhN(BYh zYlBh.^YlB=p BlB=p Buw= Btnhz(B腵Ya=p BuW= BtNh(BeYA=p Bu7= Bh(BAYH|=Hw| $dB=lB=lB2ED#= Bh(BYED=Ru h(BǴYED=Lu h(B譴YE@U=Cu h(B菴Yh(B脴YEEDE}|Ej5Y%EPh'Bht'BjvEP= Bt+D= tPnYD= uj XYYEEYBEEUTjY%EEEPh'Bh'BjmvE= t EEUTEP= Bt+D= tPYD= uj YYE= t }kEDV5$Bh'BjuuEPh'BjuEHEE@U‹UTM}~EDEYBtEEEDjEPh'BjsuuEEPh'BjZuEPY=VEP~YE,dBElBtE}~?}~E5$BuE}~= Bt 5$BY2E}EjYEM={== J= t'=t =t=t= t =(5Bhk'BhZ'Bj5t=B9j6Y%EPhs'Bhl'BjtEP= Bt+D= tPoYD= uj YYYE= ujY%EP= Bt+D= tPYD= uj YYEPhY'BhK'BjQsE=Au lBE=B*j)YEE=$BVM $B0P= Bt+D= tPLYD= uj 6YY=Bu3$B0= uF$BV= u3=BuK$B0= u$BV= tT$B0= u8$BV= u%/$B0= t$B0= t $BVV5$Bh"BjqtBH|=w | $ B=lBt7jYEPh(Bh(Bjzq=lBtjKY[^_ÐBhYjh(Bh(Bj6q=BtjoY5\@j5X@+ jQY5HBj^5LBjN=@uB=\ @u9= Bt%,Z B8t!5 Bh(B߭ h)BϭY=$Bt 5$B3Y$B=(Bt 5(BY(B=,Bt 5,BY,B B[^_ËEċ@ B) B;uEċ@dB B B8uC;u=Bt=BdBk p B9Bt G;=B|=@=\ @uhYB謬=@t/;=B|B k BPhbBhfBx Y;=B|B k BPhbBhBH =X@~5X@hB, hBY5dBhB hBYX@ PhbBh<Bjn5dBhRBhCBjnh0BYt5h BUY[^_ÐjYh/j軫HBjj誫LB=th/j菫jhiBhSBjn=p Buh= Bj$Yj5p Bh@hbBlhjBYhbBhBت B=$Bt 5$B0Y$B=(Bt 5(BY(B=,Bt 5,BY,Bj~Y5HBj苪5LBj{3[^_Ð=Bu hY=Bt?h Bl B= Bt"1V B8t5 BhBB==#= ===( Bt( BBEjuhP!Bj+l5BuZj\Yj5Bhg!Bjk5B}Yjh!Bh!BjkjY= Bt !B!BE5BujYu#YjY= tc==Bu<=( Bt ( B=BuB BEBB =tL=t<=t3 =t*y=t o=t = t Z=uQDž\*BDžX+B=( Bt( BBEjuh,BjjB =( Bt( BEċ@ E}t9uY~,Epuh!Bj3jEpubjh!Bh!Bj jEăxt=p莧Y~0jEph!Bjij YEpVYjh"Bh"BjijYjh/"Bh"BjihYB=u8= BtEph0"BEph:"Bjj,Eăxtz@8trEp$p^h/jvHBj LYEăxt@8tEpsYh,lYjY5HBj)=$Bu%h败Y$Bu B3[^_u=, Bt, BEċ@ P5$B 5$BY=hD"BwYjY5HBj蓥5LBj胥=$Bt 5$B賤Y$B=(Bt 5(B蔤Y(B=,Bt 5,BuY,B[^_Ðj5$Bhk"BjgEp$5$Bh Bl B= Bt"P B8t5 Bhs"B~5dB臿YEPh"Bh"Bj%g5dBh"Bh"Bj gB= t=u"h"B{Yj-Y?j YlBh"B5$BM5Bh"Bh"BjfjY%E$BMAM $BUP= Bt+D= tPYD= uj YY$BU= u$BJ= t1$BU= u$BJ= t }IlB= B&=@jYE}Eh#B轢YCt =Cu=Cu3EE}jh^%Buޢ uY= } E,(E@EYBtE@P=YEX@9EtiE ~ZEPfY}uhg%B7EX@lB=@u=\ @uuh%B贡=p BuKh%B5$Bot4lB=@=\ @h%BcYh%B5$B$u.h%B5$B uh%B5$BtlB4h%B5$BtlBh%B5$BtlB Bh%B5$Bxuh%B5$BatlB Bh%B5$B0tlB Bdh&B5$BtlB B4h &B5$BtlB Bh&B5$BtlB Bh&B5$BplB BEpurjj lB=lBG= Bt/=B~&=B} BBPhB B=B5lBh BhBja=lB>=hB~ hBj 5hBh BEPEpEPjjI lB5lBh)BhBj>aEpuajj lB=lBu_= Bt.=B~%=B} oBvBPhGBh,WY  B=Bq=lB/=( BhwB5(Bu.h{B5(BpuhB5(BYtPBkhB5(B0tPBBhB5(BtPBhB5(Bu.hB5(BuhB5(BtPBhB5(BuhB5(BqtPB hB5(BHt h{Y\hB5(B$t hWY8hB5(BuhB5(Bt PB5PBPB48 BhBj^= BtPB48 BhB=hB~ hB=bBu!=\@t3P5hBhB"=\@t3P5hBhB`P蒛`jShBj]BuEpS$jjlB=lBuU= Bt-=B~$=B}UB\BPh-BɚhY B=B=lB} jFY[^_áPBH|= w | $pBƅ``;t"jShxBj]BjhBhBj\Bt6PB-|=w |$B= Bt5h BY(PBH|= w | $BDž\QBDžXRB BSBB=tZ=tS===tj=tc=t =! BBDžXB BTBPBH|= w |$BDžX~B=PBt=PBt=PBt =PB u BBDžXB= BhB辘Yv=PBtW=PBtN=PB tE BB=PB uDžXB:=PBtDžXB#DžXB= Bt h BFY= B B. B\@tL=et!=mt&=ot+=su0E.E "E E E =PB t4@@PuX\h; B`PX\hT B`P辗 B] B= BtOhm BXYB B B=PB u B BPX\h B`P\`5X@5 Bh BjYjSh BjY;BwEpSjjhlB=lBuU= Bt-=B~$=B}!B!BPh BmhY艻 B=B5lBh5!Bh!BjX=lB}jY%B5BhO!Bh6!BjXEpSjjlB=lBuU= Bt-=B~$=B}BBPhB處hY赺 B=B=lB?jY2UjhBMUWVSuh")Bh)BjW=(BuDhY(Bu B[^_Ðhh8)Bh#)BjWBhkjuЯYWhH)Bh9)BjoWhBzYt9W裯Yt Sj豔jhW)BhI)Bj4W萹3[^_Ð=Bt =BuhX)BY[^_ÐEE(BU E}|(Bƀjho)Bh\)BjV,uYE}}"WYt Sj[^_Ðuh|)Bhp)BjdVE%E}= Bt EPY3(B֍N (B F|(BUEP5(Bh})BjUE= = =T=t6h)B(BP7th)B(BPu B5B(BPh)Bj\U(B=0=4=p Bu4(BEYBt(BEYBu~} t&(B= t(B= uR BE?} t&(B= t(B= u BE= BBj Yh)B(BPu E&h)B(BP虑uE%Boh)B(BPith)B(BPLu B5B(BPh)BjSE}uh)Bh)BjcSW覫Yt Sj贐詵E[^_ÐUPW3= BWh)Bh)BjS~ = Bh)B&Y=@t= Bt h)BY3_Ðף= BtL~h*BۏY;uh*BǏY'h&*BY= Bt h4*B螏Y_ÐUWVS= Bt=@t@|~3[^_ÍBQww,pjw,h*BjQ(t w(YhYjh*Bh*BjPHjh*Bh*BjPww0jw0h*BjP4t2jh+Bh*BjPjjG4ЃVh+Bh+BVh,+Bh+Bj]P\@[^_ÐUPM=( Bt( BÐ%=|%=~-+BÐ%HDB@ UPM=, Bt, BÐ%=|%=~.+BÐ%HDB@ UjhH-BѥUD-B3<-B<-B=-<-BEYB<-B=~<-B<-BE=rt3=ctFp='t-K="Aƀ<+B"JAƀ<+B :Aƀ<+B'*D-B=bUAƀ<+B=nt-;=d0Ɓ<+BD-B<-BÐAƀ<+B =qAƀ<+B?=wtA=tt$=sAƀ<+B iAƀ<+B V8+B<-B@EYB0<-B<-B%8+B<-B@EYB<-Bk8+B <-B£8+B=xuAƀ<+BEEYBE%E<-B@EYBta<-BE<-B ˆE<-B@EYBt%<-BE<-B ˆEAU<+BA<-B<+B<-B Ɓ<+B3ÐU=`.B~h`-B5`.B `.B=d/B~-5d/Bhd.Bj } @d/BÐUWVSDže<+BS苉Y~ FؾVSh/Bj7u/jY@-Bjh/Bh/Bj6[^_Ðƅ3D=G|hPtjhH-B脡Yu58+B訣YO@-Bj菣Yjj蠈jPh/Bji65@-Bh/Bh/BjO6=`.B~h`-B5`.B`.B=d/B~-5d/Bhd.BjC } @d/B[^_Ð3ǍWMъTGF;|jEYPh/Bh/BjdJ FT=4+Bt`.B`.BVT`-B=@t0=AuFD= td/Bd/BVTd.BPnY=sFDP0YPP6VEPSF u3@-B}=`.B~h`-B5`.B`.B=d/B~-5d/Bhd.Bj } @d/B~ Dž=@-BZU WVSh/BDh<+BiYWh<+Bh/Bj4hPtjhH-B跞Yj۠Yh0Bh<+Budj8YPZY=4+Bt h0BY=@=p@h 0Bj@h0Bh<+B蔅t,h0Bh<+B~th0Bh<+Bhu>A=4+Bt h0B~Y=@t6h'0Bju<+BJh/Bj迟YjjЄu h/B[^_h,YgP7YC;uWh<+B=4+Bt=p@th<+BW跼=@t&=p@th<+Bjb} @=D-BRj %7YP讯Y=@6=p@)j 6YPjG_UWVE<-Bjh/0B50+Bj1=X@} ӦX@j5@h@hbBӋ}(hbBh00Bh<+B菃 h<+BwY3^_Ã=@u=\ @u=At 34+B=4+BtO=A~FA,BЃ:u A4+BA,BЃ:u TA4+B=4+Bt5X@hbBhE0B蔂 <+B=<-BP,YPh<+B輂G?ujh<+Bhn0Bjc05bB5X@}h~0B+Y3^_ÐjjJ<-B<-B8t<-BEYBu@-BF<-B<-B=-&<-B<-B=-;=@-Bt<-B8t&<-B<-BEYBt<-B<-B8t<-BEYBu<-B8t uN<-B8 Vj3=4+Bt h0BYjh0Bh0Bj.^_ÐVj=4+Bt h0B諀Yjh0Bh0Bj.3^_ÐUW=@u =4+Bts~=`.B~h`-B5`.B辸`.B=d/B~-5d/Bhd.Bjj } @d/B]+_j腱YE=4+Bt`.B`.BU`-B=@t#=Au} td/Bd/BUd.BO=`.B~h`-B5`.B`.B=d/B~-5d/Bhd.Bj } @d/B_ÐUÐUÐUÐUÐUÐUÐUÐUÐUE@uYÐUjju@ u=YÐU=BtB%=u3U졸B%=uÐ1BtjZ5YB%thxj1BM4 j|B@HP|B@P|BPBfxthxj1B3 1B=thxj1Bph3 |B`,|Bx,t<1Bf@f}.1Bxu#hx|Bp,j&6 |B@,B %t)hxj1BW3 BBH1B|B@hxj1B3 1Bthxj1B2 1Bt!hxj1B&YP2 Bp({Y3U1BBE1BƀB iȡ1BUBÐUP=L1Bt=Bt5BgYBhl[Bh|[Bjjjj u'1B=tr%WfjȬYL1Bjj{u hRj{jj{uhRj{jj{uhRjs{xBÐUPWVSE9EuE9E u 3[^_ÐB%1Bxu9|Bx,t.Bx4u#hx|Bp,j3 |B@,1Bx u:B %t)hxj1B0 BfEfP1BB@bEށ}CB@=` /}%|B@9E}  |B@9E 1BxTt`E@9EuWE 9Et}uI1Bx0t>E 9Ethxj1Bp0/ hxj1BpT/ E9EE -9E}sE @9E~hE 9E}juu juu  ;]}9E 9E}juu  Ljuu  3|@}|:|B@9E},} |&|B@9E }juuu uء1BxXtjjuu1Bxptjjuu}|%||| [^_Ð9]39}.9u)hxjuu1BpPK" PZ. E;;juuu u$j; Puu#|BfUfP|BfUf3[^_UWVS}u1BxXB@@3 1BxpB@Bء|B@Hu [^_Ð}uju ujV2[^_hxjWo- ju ujV[^_UWVuuu! uuu f ^_ÐUWVSE 9E<9E}u +uBXHޡB@^u+u BXJޡB@\ȡB@dЃ}u&;};} [^_Ð;}[^_Ð[^_Ð;}0;},hxju 1B$Z Pi, ;}XE 9E}(hxjV1B$ P3, _hxjV1BP , 7E 9E} 1BxT1BxthxjW+ N3[^_UWVSE 9EB@dE 9E}ju u ju u B@L=}"ju j BRLЋ؃}u#;} ;}[^_;}[^_Ð[^_Ð;},;}(hxju 1BpHP* [;}(hxj1Bp0* ju j9 ,E 9E}ju u ju u 3[^_ÐUWVS1Bxlu1Bu [^_á|B@DP1B<1Bf@f|B@4P1B31Bxltu1B@t#E =BEE=BU+Ћ3؅~E=BBEEB@NÉEEEE}u'B@`;E}B@`[^_ÐE[^_áB@`;E}2hxjE +EP1B4PC) B %tFhxj1B) Bhxj1B@( KEE1BxuuE%|B;B,t71Bxu,tfY[^_ÐUBB@(}Bp(EPeÐB@(P@EÐUPWEЋxRW5xB% _ÐU졠1Brt&1BnPhT1BlPe 3UWVS}G%utu [^_Ð[^_U<WVS}uh1BBeYE}t Eu1BEDž}t Eh1BeY>VeY@ueYЁ~f1BVPgeP]eYЋ/FFU/FuV2ejPd} =L@ }Vh1BPdPdYЋEFuVdjPHd}f=L@ t!jh1B,ctf1B'f1Bf1B}t EuhB?dhPc bYf1BCuf1B( BW[Y9uW>YW.YWYWYWYDž=1BhbY1Btzj&bY1Bt]j>bY1Bt@h~bY1BB91Bt 51BaY51BaY51BaY51BaYf1B}u 1BPHYR[^_Ð1B1BB1BB1BЪB1BBxs DžBuaY(}t Eju1BP b 1Bƀ1B1B1B1B1B1B1B1B1Bǂǀ} uu `YuE 1BfU fl51B<Y1B1B3f@ы 1B 1BB 1B1Bƀ1B1B 1Bǁj4j1BPS` 1BnPhT1BlP_ 31B1Bn JHJHJ H fJfHWV_ 1B@%51BG;sFӁu;s+PjV_ tG1B1B@<;WbY;s#} fffu;s#+ùEPjS^ Phju ^ =t5t+t!1BffP1BffDžDžh 2B+^Yh2B^Yt&n]Y~1BffPt%?]Y~1BffPhhTu ] =t7fft+fft1BffP1Bff1B1BAWY;s'} Ëu;s#+ùPjS] W] 1B%=uM1Bf硠1Bt&1BPhT1BlPt\ 3 1Bxt1B1Bǀ1B@+1BP51B51BW\ 1B@(1BR+P51B1B@P,\ 1Bl1BR(+P51B1B@(P[ 1BL1BDžU1B ɉ t1Bx1B p |1B41B1B@=u$1Bxu1Bf@f| 1Bf@DžU1B<t04P[u1Bx1B r1BǀDž1B ɉ tI~04Zt/u@41BZu1Bx1B!O1B1BR\t1B1BRhx1B1BRx|3[^_UW}LJLJNj3ffffhjPQY _ÐU졠1Bt&1BPhT1BlPX 3U졠1BnPhT1BlPX 3ÐUPEPju  |EÐUPWVS}u ]΅u&3[^_Ð=$u G=<tKFGt?uۋ[^_À?tG=>uސUWV}W=nc=bstO=ns=pttuE%juh6Bh2BWyLE衤1BE}3^_ÐjEP1Bp` t=u F3^_ÐjEP1B@ t= uFtJ3^_ÐjEP1Bp0 t&= uFu3^_Ð1B,u ^_Ð3^_ÐEU^_ÐU WVS}jQh,7Bhh2BW`K1Bu [^_Ðs[^_ÐUWV}u Ecjuh7Bh2BWKE1BE}u3^_ËEUEt>tu6VuVY@E^_ÐUh6Bh[BUhB1B4l5Bh[BU h6Bh[BrUÐU졠1BU1BǀÐUWVSDžl},BBDž`E \EX1B} ,DB%:uGDžӈGht&=t = `t1B@TDžh1B@lT`t;Tt21B@H9h} 1Bxtth1B@tTTt&1B@P9EuTh,DBThFhlllpTPTYlBlpO\X;G-1`=UM$DBl@l\pl@lXpl@lUpl@lUpl@lUpnl@lU pRl@lU$p6l@lU(pl@lU,p1u3`=a|2=z(Gl-alpT=A=ZGlalfpf Pf=a|2=z(l@lGaTp,=A=Z l@lGaJpl@lGpG='DžhDžd=-uDždG=+Gllpllphl@lhӉpllpllphl@lh+Ӊpllpllphl@lhӉpzllpllphlBlp0llpllphl@lpllpllphl@lh#Ӊpllpllphl@lh ӉpCllpllphl@lh3Ӊpllpllph9hllpllph9hwllpllph9h|?llpllphhtG3lBlpllpllphh랐lpu3lp{lp҉p`llpuJjeW;j;W)- V=^KC$EBGuh,DBVM,BB[^_Ð%t FӈΐlphG뉐- |=w |$DBDžt u͋=Xt =dt=ot=st =xӈsuhPV:L hPV L F>ulkh -0hG؃0|9~܃}t3[^_Ël@ldhpUWVS}3E=%u8GU ;t=;u u [^_Ð=?uF=;uNGu3[^_ÐUWVS}3EE1B@,9FBt1B9FBuEEYBt!k G-0EYBuk =.uuGt1Bxt}u[^_ÐCPUY[^_uV4[^_ÐUW}t?=FB2=$uG=<uuu W GPUY?u3_ÐU|B@,h|[BHYjjIhjtI|B@5|B YÐUjuFI|B@,}u KÐjyYÐUW}1B} _Ð}1B9tF~1B}W>YW1BuWY1B3_Ð}뾐UPjj1BG Ѓ}t!Rj1BdG ÐU졠1Bf}~M1Bƀ}c~E@cd1B1BƀUÐ1Bƀ1Bƀ1BƀАUWV1B|WFYuatYtjVJG1B^_ÐUWVS}u ]Bt3E%E%E}%~fE%~fEE~fEfuE!E1B@=t1B@ EfEftE!EfEftpE!EE9Et:jSuu=u"B@xEfEEйf fHEU;tSEPEPv [^_ÐEU;tSEPEPP E9EtjSuu [^_ÐU$WVS}u ]E1B41B@E1B9uE܉}uEU܍‹1B#Et!EU܍‹U!E܁LEE|[E}~DE5EU܍‹U#x1BtEx1B EMt E} |ȋE܋UTEM܅H}u;1B4ttSj%P%P%@P% P%P%P%P%P%P1B4Y(Ph Ep1Bxu1Bf@f|3#DžE#3ƅEEu1BU#9Ut)Sj1BYP E3]EMEU#x1Bt8Sj1BU4YP Ex1B#EE}|3#DžEteEVEU#x1BtBSj1BLU4$YP5 EEx1BЋU#Ѕ҉Ut E} |1Bf@f~Sj1Bp` 1BE[^_ÐUWVSf}]BEB@xEfu>Sj1B{YP 1BtEf@f[^_á1Bt*SjP1B+P: [^_ÐEkDUR;tCSjEkDP1BP EUkfT fPEkU;LSjEkP1BP EUkf f[^_UWVS}u uVPq =u [^_ÐPWw*[^_ÐUWVS}EGE;=|BtGG3GGG$9E|G&9E fG&GHffG W^Yf;EfEfGWDY;=|Bu3[^_ËÈGtW'YO ƈGt WY[^_Ð3[^_ÐUWVS}GGE+Pw0WDЍR+4 =BtSVE+PjWB;=|B|B@p;||B@fUfp|B@ p;|'|B@p;~C|BR fru3BRBx4nB@4EBE𡈟Bt 3EEù@EYGp;~ GfpG UJfpO tW9&YGt WOY[^_Ð3[^_ÐEUEE9E|ùEÙ҉UuEEM E}|桸BtvBEù@EEUEE9E|ùEÙ҉UuEEM E}|3[^_ÐUWVS}u ]||G;}G;| [^_ÐfGfO GtWY[^_Ð3[^_ÐU$WVS|B9Eu 3E}t%|Bxt}t |B@3[^_Ð}uB9Et u3Y'1B=t}u |Bxt B@|BffFB|Bf@fFBB@4FBBFB|Bf@fFB|Bf@fFBBX0BB%BB%=Bfxthxj1BC tBB%thxj1B 1B=t*hxj1Bt1B4 hxj1B hxj1Bl 1Bt hxj1B]YPnhxhj BH1BBx1Bxt"hxFBP1Bp< |B|B3f fHf FBf FB|Bxu5|BһYdFBEFBt3U+ЉUFBHE|Bx|Bp B@EEEt;tH=uBB@B@:EB@<@E𡀟BUUPBUUP FB;}u0#1B=uBfUfP:}}4uuE졀B@(%tuuBEE9EuuuGE9EuB|BfFBf|BfFBfPB|BffFB|Bf@fFBFB;} uYf>fEE9EtH=u ;uBBEB@EFB9Eu FB9Et2uuFBPFBPfEfFBfEfFB|B@BP(P(BP(P(1BƀBfFBfP:Bf@<|BfFBf|BfFBfPBp(6YB[^_ÐfFBffEE=FBt&EEFBUUM}}M}}B|B3ɈJ|BJHtBjFBPj5BoBf@:BFBJfP<FBEUWVS}FB9FB}H=FBt 5FB 6YFBPU6YFB=FBt FB3FB=FBuB@D[^_EFBB@D4B@EBEEE%;E%= uF% U}~&C%= u% C*E9E|9}uE% E%EEFB9ESFBFBЃڃ}uuFBH;uECt<}t %FBH;u}t C%C;}u%FB9E| FBHEBfBFB[^_ÐUXWVSB@UP=u 3Eˡ|B@ UPEС|B@PÈ}uB@ P=u FB9E}!1Bf@fB@DU[^_Ðu@Y|B@DU4}u1Bf@f|EFBCB@UPEB@ P=u FBB@ UP@E}ENj؋EƉEËUE9u EE9E|E9E#ЃڋEЃUËUm9u ME9E㡠1Bx@tbE9E}ZB@ UP=u EEEHENj ; uME9E}B@RU;U| FBE=FB FB9E|EHEE؉E܍NjuM܃E9E}=FBt2E؍Nj~uM؃E9E}E9E}E؋E9E}EFB9E|M܃=FBtFB9E|Mء1Bf@f~FBH9EuFBH9EuM܃=FBt+1Bf@f~FBH9EuFBH9EuM؀}CB %uB%B@(%E9EE9E|FB+E==FBuEFBHENjEEEʸFBMM #uZ=FBt7EEEʸFBMM #u 3tME9EfFB-9E| FBEE9E}9E| FBEFB9EtB%u E&FB9Eu FBE E@U+ЉUԋEE3EʈEȃ=FBt3E}u%9uEE9E|E9E} =FB1B4E9E9EE ; uEE9E|ME˄t3E̋U+СB@T;uuFBPFBPh1Bxthxj1B4 fEfFBfEfFBE+EEPWV0. EEEEEFB;Eu FB;EtuuFBPFBP跲fEfFBfEfFBEċE}u E9E=FBt|BUP,E9E1Bxthxj1Bp@ |BfUfP|BfUf5|BY=FB~}tFghxF%Pj |B@,Htjuuc H~juu E9E~HEPuԋE+EPVWEt)E)EԋEEEB %t)hxj1Bx BE%|B;B,EE=FBtE%|BR,;tE=FBtE%~|BR,~;tE=FBt}u }9=FB}t }}t4EܹEEܙʸFBMM #tY}=FBt 30|B@,EEE}}EܹEEܙʸFBMM #EuuuuNhxB@DUUJ%PB@DUU܋%P |BBRDMM܋P,juu E}}=FBt=EعEEؙʸFBMM # 3EEtEEEE9Etuuuu=hxB@DUUJ%~PB@DUU؋%~P |BBRDMM؋~P,juu< EuuEtEEPu蠭|BUP,hx|Bp,E%P{ |BUāP,}tVuu  }tVuu FBH9Euul Y1Bxt81Bxt-E%=_uj lYuuE@Puܬ1BxtE%=~u`EP+YƋUĉEfFBE9EE9EO}E|B@DU4 > uEFB9E||B@UfMf PFB9Eu|B@ fPVFBHE|BU@D‹U > u M}}|B@ UfMf P|B@UPFB;} 3BRM[^_ÐUWVSB %E%= EPEPuu uGE~91Bt B@X B@>EBR:ЉU E>E9E1Bxt B%B %tGB %hxj1B BUB %t)hxj1B Bhxj1B{ 1Bt.hxju1B8PG \3MB%?E %= *EE;E}EEEEPuuuu }E3UЃ: t3 C;]|⡸B@<EE𡸟B%teB %t3 B@8EB@V;~B@V;E}B@VEM1BtE9]|ՋE@;}|B]P[^_ÐFB;|CFB;|}uQ1Bxt5hxFBP1Bp<; fFBfFB5|B1BxDu!1Bg1Bx XjuFBPFBPbfEfFBfFB1BxthxFB+EP1BxDt 1B@D!FB+EP1BMP\ |BfUf5|BYjFBPu5Bq[^_ÐU졬1BtJBf@zf~t<EEEEE;E~ EfUfE;E} EfUfAEE;M|}܋G@E܃}K[^_ÐUWV}W<fGW:fFw@u^_ÐUWVSE@E9E | [^_Ð} }E E E;E~ E+E EEU UPU UP }tH 3@HE:>EE` %}t =t ffEfEMԃ}uExt u!Y}uExtu-Y[^_Ð3[^_ÐUju up ÐU졠1B=tT1Bf1Bf1Bƀ1Bƀ1Bƀ1Bǀ覼3ÐUP1Bt~1BB= tk1B|]1BBFjEP1B ~11B1BBBfMf PÐ3UhEGBh[BhȟB81B4FBh[B hMGBh[BÐUPWVS}1Bxu{1B%E}~}r [^_ÐEETGB1Bt1B3ۋǙSU YO3[^_ÐUW}$t w$Yt w@Yt w1Yt w"Y0tG08t G00 Yw0Y4tG48t G40}Yw4tYt weYt PYt ;YW4Y_ÐUW}u _ÐWY| YBu$1BB9tGY9YYYYWY3_UPWV}fG8f~ ^_ÐtGfWfPwY@uGmG@ EfH8@@E}u=Bt w&YwDYwYW Y3^_ËGD4Y=Bt G4YN륐U5BYÐU WVSh Y1BHuf1B[^_Ðhj+WC ]tGB]uGBK桬1BHt' FEFEEU>uމ=B=BtVhfY1BDET3 E  fXC|ًEğB3[^_ÐUWVSBx851B3ۡ1B@E1B@1B1Bj1B}u$GBhuu GBڃEj1B}u$GBhuu GBڃE3f1B1Bj1B}u$GBhuu4 GBڃEj1B}u$GBhuu GBڃE3f jCEGB4}u$GBhuu GBڃ뫐jj CEGB4UP}u$GBhuuB GBڃf|jj j1BpP P}u$GBhuu GBڃfjj1B$譸P}u$GBhuu GBڃf1BUP[^_ÐUGBÐU}uGBhu uB GBU(WVS}u jH YtlP YCDtP=BtPj Ct%}EPq YCu,s YsD YS Yf81B3[^_Ð}CC 3fCffCfCfEfCfEfC B@EEu%B@B;|;5B|3CC(EC(EC(EC(E3CCEME% ЉEME% ЉEME% ЉEME% ЉCC(% C(3fC$fC8GfC&C0 fCX}u=t;E}EE}u=t;E~EEE9E=t E=u Ef9EUU;~ EUUfEUU;} EUUfEEԋBR:;}BUUfP:EEԋBR<;~BUUfPfEUUEU‹U؍‰EE+E@Puu EEEEEEEE9EkBH g 3[^_ÐU(WVS}GtZE+EE}EE+EE;E~EE܋E9E$}|;E~fEf;E}fEfEEEE9E|O A<EA:EA@ȅ![^_UPWVSE؋E7F@9uVYKEt$YEt YuVY[^_U$WVS}u GE%E%EEGEE== tj= tv} r }GE3GG} ufE EÙ=BB+‹ЉUG;GEWY!K}3ۋfGO E ^PW =tE5@ EPW=uEGEEGEG uG0%E~t G,%G, E܋ uGDU;4t_GP;} Gf PG UP;~ G f PGDU4=BtGց ΁ fXCG;uCG&9Eu2jW=uEG;uKEE3EfEffGtW3Y}uVWB[^_ÀO }uW0Y[^_ÐE[^_uWw=C;]|~UWVS}G(%t G t [^_ÐGEGE3GGGG$;|G&; fG$ffE PW?fGfEGtW?YEGt WRY[^_3[^_ÐU8WVS}=BtBEB EW$;|W&;G&@GE} }3+EE;E ~EE E+E EE+EEE7U+ЉU;U }EE EHE+E EHU+ЉUEfG8f @u3E܋GEЋG EGE}GDUEGDUWDMGDUM ;=|BBx4B@4UEࡸB@4UBR4MB@4UM BtuBUEࡸBUBMBUM (EPGDU4GDU4 ;=|BuCEЋUfPUЋMfJE̋UfPUfJB@UBREЋUfPE̋MIf PMEEE}w} } E+EEHU+ЉU}~^GEGE3GGGfGfEfW蟽YMEE}fGfE؈GEԈGO }tEȣBjSuE+PWBtWY;=|Bt}t WY[^_Ð3[^_ÐUPjjntRj]GB@GB=ujPÐUW}hGBtGBP9_ÐUuYPYÐUWVSGBGBGF҈uEk@HBGBGFGFGGEXk(HBGFGFG3Wu@dPWa@dPWM@dPW9Exd|G2G0E@@dPWGB[^_ÐUW}G} |E B0G GE B0G_Ð)`ÐU$WVS} uL@3[^_Ã} }u$u %YEuL@ 3[^_ÐEPY} 3[^_ÐE}u8Yu/Y3[^_Ð}ubuY}t jYjju uYjYjh\HBjhPHBhPHB jYuY}+EU +RWuw uYjjzEjjkEjj\Eu =L@uj*Y;Euuj,ujuj;}uL@ 3[^_ÐǍV= tL@"3[^_ÐǍVE[^_Ð/ÐÐ/ÐU$WVs%|WjhtHB9|Bjk$PV j$EPV. =$tV=Y3^_ÐV.YE܄u3^_jEPhhHBP pHBhHB^_ÐÐUWVuOt7Vuh^_ÐUWV}t9~u>^_U=HBuhLBhHBHBÐ5HB YÐU=HBt5HBPYHBUW}G?t=:t = u= u ?tG_ÐU=HBu hLBhHBHBu3Ð5HBYÐUWVuhhHB =LBWIY=LBW:Y=:j EPWq WoYPj:W 9EuZWY|`~aƣLBt3=:t)j EPW WYPj:W 9Et3^_WY|`~aƣLB=LB=LBWcY=LBWTY=LBWEY=LBG?t =,u?tG=LBLB^_øÐ 3ÐPÐÐUW5L@Y}t1Et(uYPuj+ jhLBj WYPWj jhLBj _UWVSEPYg=LBuijj$LBPYLB=LBuL@ 3[^_Ð=LB LBLB;rߋE =ruEEE =ruEEE=LB"?t+LBPYLBLB;rɋE =ru3EVYY9]t uKYujSS 9]tS1YjuhLBhLBhLBjIY}u 3[^_ÐLBUSYu V[^_ÐUWVE@ uYjjEjjEjjEEPH$Y=LBtLB;4tu܃=L@tӃuEujMuj@uj3=LBt LBE^_ÐUWV} }}L@ 3^_Ðt?F EF F F3҉V0_B=at=rt =wt3^_ÀN jju0 N G=+uf N ^_ø*L$Q3ÐUW}WaYjjG P GGg G tg _ÐUPU Ruhl[B[ ÐUPURu uA UWV}uEljEEWYEE=Gt2 =Et)t=XtPk=ft =et V=guMEE +=ut=ou0E=xuELB}WY3[^_ÐGG=+t=-t=0t<EMLB} WY GG؃0} i}LB} WXY GGE=xtE=XG =<t?t#LB} WY GGE,jVG P =u EELBEEYBt=w7|3$XB}t#=lXBM|ƀQhhXBYpXBH|G=w@|<$XB}t,tXB+TXB=M|EQhpXB2YE;u;uE9E|0EE9E9u}E}tTXBE琐PXBU+ЉUEPYEG ^_ÐUWVSEQUE؃}}EQKE<XBEXBƙXBpXB| FYF!Ft mnN|܉5XB=XBƹtmn=nuyXB3 xXB+FxXB;}yXBGXB5XBXBXBtmn=nuyXBXBXB+…|FfXB*wXBFEXB™fuXBF |yXBXB[^_Ëƹt mn+Fƹt mn;}U\WVS3EEEE3EEEjjEP jjEP h YBZYEtEEW [^_ÐE=t E=uM}}mEiUQPǹ +x }|b} \EUP=.uFE@EGv}|2},EԊUP=.uE@EGI}|}~5EԊUPǹ +x H|=w| $XBEE==/uGE@E#}u3 EFuEE̋UЋEPǹ +x EdXBEУPXBẸTXBEȣXXBE\XBEģ`XB}uZ hXB pXBiXBjXBkXBPXB lXBqXB rXBsXBTXB tXB&jEPhhXB] jEPhpXBJ =K+=2v=tWY=]= f=:uEE@E EƉE3Ed}u EEE3P<=,u&}E<E@E =;u"}uE<E@Eu x= ===w=)|=tl=Ju# =xEEċEЉE,=:PhXBEEGtPhXBtWE+EE@PYEuuuy EU uEEEĿ(E@Ev=(d=-t=+u,=-u E܋E@EG-EYBu*EuxEEEE-Ēu x2=+=*=-EEƉE3E2j=F!c=?2===<,=>=A=@=H=G=I=d}{=\?=Ztg=P=,u }up=;u*}[ǹ +x E@EA6EU;u2E%= u"t EU;uV@YYB[^_ÐVYkjV{OuV Y3[^_ÐUPWV}7Yw CYWh~PWU =uh~PhDYB 3WIY^_ÐL$tÐT$ÐÐ@ƥ@@F@@@&@p@@@@A@@@0 @ZZZZZ@#@#  &Y~   ##~ @ @C-Kermit 5A(190), 4 Oct 94Copyright (C) 1985, 1994, Trustees of Columbia University in the City of NewYork. The C-Kermit software may not be, in whole or in part, licensed orsold for profit as a software product itself, nor may it be included in ordistributed with commercial products or otherwise distributed by commercialconcerns to their clients or customers without written permission of theOffice of Kermit Development and Distribution, Columbia University. Thiscopyright notice must not be removed, altered, or obscured. For further information, contact the Office of Kermit Development andDistribution, Columbia University, 612 West 115th Street, New York, NY 10025USA; phone +1 212 854-3703, fax +1 212 663-8202, email kermit@columbia.edu.C-Kermit Server REMOTE Commands: GET files REMOTE CD [dir] REMOTE DIRECTORY [files] SEND files REMOTE SPACE [dir] REMOTE HOST command MAIL files REMOTE DELETE files REMOTE WHO [user] BYE REMOTE PRINT files REMOTE TYPE files FINISH REMOTE HELP REMOTE SET parameter value REMOTE QUERY type variable REMOTE ASSIGN variable value Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. Can't initialize!Can't allocate i/o buffers!Can't open device: /dev/ttyCan't allocate packet buffers!main argc after prescan()Interrupt during initialization or command-line processing.C-Kermit quitting...main executing init filemain exits init filemain cmdfil checkmain argv[1]main cmdfilmain argcckcmai got interruptckcmai setting interrupt trapcl_commandsgetiobs ok@ @/@8@ %$%,%4%<%D%L%T%\%d%l%t%|%%%%UNIX Communications support, 5A(160), 4 Oct 94 Interactive UNIX System V/386 R3.2/dev/ttynonettgwsiz tt_rowsttgwsiz tt_colssysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! sysinit jchdlr: SIG_IGNsysinit jchdlr: SIG_DFLsysinit jchdlr: otherttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 *NOT* definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen got open fdttopen fdflagttopen alarmttopenmodem ttyfd alarm returnttopen ttyfdttopen tty access denied/dev/null%s is not a terminal device ttopen not a tty/dev/tty ttname=CTTNAM cname ttyname ctermid ttyname redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %s %sttopen ioctl TCGETA ttold.c_lflagCan't unset O_NDELAYttopen ttspeedttopen, ttyfd lcl lock filettclos ttyfdttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donetthang get settingstthang speedtthang turning O_NDELAY ontthang TCXONCtthang close(open()), OPENFLGStthang restore settingsttres tty modes restorettres errnottrpidttrpid PIDSTRING read%dttrpid pid/usr/spool/locksLCK..%s%s/%s%s/LTMP.%05dttlock flfnamttlock tmpnamttlock creat failedUUCP not installed or Kermit misconfigured %10d ttlock hdb pid stringttlock fpidttlock killttlock kill errnottlock removing stale lockRemoving stale lock %s (pid %d terminated) ttlock unlinkttlock found tty lockedttlock can't get fpidWarning - Can't remove lockfile: %s ttpkt parityttpkt xflowttpkt speedttpkt carrierttvt ttyfdttvt tvtflgttvt speedttvt flowttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failsttgspd ttyfdttgspd codettgspd speedmyfillbuf readSVORPOSIX myfillbufttflui ttyfdttflui ATTSVesctrp caught SIGQUITSVR3 job controljcconbgt jcconbgt jcshellconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconint SIGSTSTPconnoiin_chk conescin_chk my_countttxin nttxin MYREADttxin myread returnsttol nttol sttol tryttol okttol failedttol partialttoc timeoutttoc flowttoc errorttinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl myread failure, nttinl myread errnottinl myread ittinl lengthttinl length^C... ttinl skippingttinl EOP lengthttinl ittinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttsndb ttyfdsndbrk ATTSVCan't send BREAKHZmsleep ATTSVgtimercongm getting modes/dev/ttyconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb cccbrk.c_flagconcb c_cc[VINTR]concb returnsconbinconres cgmfconres isatty okconres restoring ioctl conchk contypconinc(0) errnoconinc HORRIBLE ERRORconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlsuspendpsuspend errorpsuspend ok)@@)@d)@k)@p)@w)@~)@)@)@)@;Zx0NZ8\4[8\8\x[8\8\[8\8\[f0@'UNIX File support, 5A(098) 4 Oct 94 Interactive UNIX System V/386 R3.2rm -f pwd ls -l ls -l cat df df who zopeni fpzopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinr zopenizopenizopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULL zopeno fp[]=stdoutwazopeno failed errnozopeno okzsinlzinfill errnozinfill ferror zoutdump charszoutdump write okzoutdump write errorzoutdump write returns/dev/nullzchki stat failszchki skipping:zchki stat ok: access failed: access ok: length/dev/nullMalloc error 46 izchko access failed:zchko access ok:zrtol original nameNONAMEzrtol new namezstrip beforezstrip after tilde-strippingzstrip afterzltor name2zchdirzchdir 2zchdir 3zchdir 4zchdir 5HOME.zgtdir CWDBLwzxcmd pipe failure/bin/shzxcmd pid/dev/nullSHELLzxcmd...-czxcmd fork failurezxcmd pidwrzclosf filnumzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzxpand entryzxpand after tilde_xzxpand okzxpand fgen1zxpand fgen2 okzxpand 2 not okznextznewn: about to expandznewn matchesznewn number ok.~%d~znewn: too many names.~xxxx~zrename oldzrename new/zrename dirzrename no dirzrename link fails, errnozrename unlink fails, errnoU1zfcdat stat failedzfcdat date failed%04d%02d%02d %02d:%02d:%02dzfcdatzstimeBad creation date zstime date check 1Bad creation date zstime date check 2Bad creation date zstime date check 3zstime so far so goodzstime yearzstime 4 bad date zstime 6 bad date zstime 9 bad date zstime 12 bad date zstime 15 bad date tmA-pkt date ok Can't stat file:sb.st_atimeCan't set modification time for file: Modification time is set for file: zstime comparezstime comparepacketmail %s < %s%s %s < %slpecho%s %ssplitpathsplitpath mallocsplitpath malloc failurefgen patfgen string spacefgen can't malloc string space addresultmatch strmatch skipLOGNAMEtilde_expand?Privilege cancellation failure /bin/shsh-c/bin/sh/bin/shSHELL-i-cisdir statisdir errnoisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseek5@5@5@5@5@5@5@5@5@6@}}}}}}$<<̂؃,I,IC-Kermit functions, 5A(120) 18 Sep 94Error receiving filerenamereplacebackupappenddiscardaskupdateencstr string too bigencstr fits OK, sizeputfil zchout write error, setting czseengetpkt: empty stringgetpkt: input errorgetpkt: empty filegetpkt zminchargetpkt fmaskgetpkt new rtgetpkt leftover osizegetpkt eof/eottinit getsbufTransaction beginsGlobal file mode:binarytextCollision action:resetc fsizesinit: no memory for cmargbufsinit nfilssinit cmargsinit cmarg2stdinsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamTransaction beginsGlobal file mode:binarytextsinit oksipkt pktnumsipkt ksipkt getsbufxsinit kNONAMErcvfilrcvfil cmarg2Receivingrcvfil substituting cmarg2rcvfil zstripUNKNOWNUNKNOWNrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2rcvfil discard refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure.rcvfil: nreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof successmailed toprinted with optionsreof returnssfile cmarg2sfile fnspathsfile zstripUNKNOWNUNKNOWNsfile pktnamsxpackSending as mode: binary mode: textSending from:SFILE fsecssdata entry, first drainsdata draining, winlosdata sbufnumsdata countdownsdata packetsdata cx/zseen, drainsdata eof, drainsdata ttchk *** interrupted, sending discard requestseof can't get s-buffersxeof nxtpkt failssxeof packetrpar 8bq sqrpar 8bq ebqrparentering sparspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar lscapuspar yspar lpcapuspar lp lenspar lp spmaxspar windowspar window after adjustmentspar windowspar no windowsspar sending, redefine spsizgnfile sndsrcTransaction cancelledgnfile czseengnfile nfilsgnfile cmlist filnamgnfile zxpandgnfile donegnfile znextgnfile skipping:not sent, reasonDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremsetadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new len !"$'(+-.03569:(resend)RESEND PKT NOT IN WINDOWRESEND kresend pktinfo indexToo many retries. retry(resend)(resend)entering rpack, pktnumrpack getrbufrpack: ttinl failsrpack ^C serverrpack ^C en_finrpack packet length less than 3rpack bad sequence numberrpack echorpack bctlrpack chklenpacket sticks out too farrpack block check Bchecked charsblock checkshould bechecked charsblock checkshould bechecked charsblock checkshould bebad type B block checkrpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d-Transaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate complete, sizeWZ#Z#R@R@R@R@R@R@R@R@R@ S@S@S@%S@0S@;S@BS@IS@WS@\S@^S@`S@bS@dS@fS@hS@jS@lS@nS@pS@rS@tS@vS@{S@  <Dtinibufs sinibufs rini_pkts: no memory for s_pktini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmksbuf makebuf returnmkrbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf, packetgetsbuf, sbufnumgetrbuf rbufnumgetrbuf wslotsgetrbuf dum002getrbuf dum003getrbuf new rbufnumgetrbuf foulupfreesbuf sseqtbl[n]freerbuf, slotfreerbuf no such slotfreerbuf, packetfreerbuf, new rbufnumfreerpkt seqfreerpkt kfreerpkt freerbufchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%5d%6d [%.72s%s] ...free: %d, winlo: %d %ld%ld%dsattr pkt too longsattr spsizsattrsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsize23456789:;<=>name@nameunknownrsattr: refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgattr file typegattr binary refused: typegattr restoring binarygattr attribute A = textgattr attribute B = binary refused: dategattr encodinggattr unk encoding attribute refused: encodinggtattr: no memory for dsbuf refused: dispositiongattr RESENDgattr: no memory for spbufgattr length refused: length refused: length%ldgattr fsizegattr RESENDN+gattr RESEND not binary%ldgattr RESEND OKN?gattr returnAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text opena charsetFailure to opencanned: cxseen czseenopeni sndsrc file numberauthorization failure openi authorization failure ok zopeni okcould not be opened openi failedopeno: name open cancelledauthorization failure openo authorization failureopeno failedFailure to openopeno ok, nameopena restoring binaryclsof dispclsof restoring binaryFailure to closeIncomplete: discarded incomplete: discardedIncomplete: Kept incomplete: keptClosedc@c@ Y@h(P8(dDP<8  0   x ,pXhpx (0!666666666666666666666666666666666666466666666666666666666666666666666666666656666666666666666666666666666666666666666666666 6666666666666666666 666666666666666666656666666666666666666666666666666666666666666'664#66666666666666666$666666666666666666665666666666666666666666666666666666666666666%66&466666666666666666666)6666666666666666665666666666666666666666666666666666666666666666(466666666666666666666*666666666666666666566666666666666666666666666666666666666666666.646-6666666666,666666+66666666666666666665666666666666666666666666666666666666666666666646666666666666666666/666666666666666666656666666666666666666666666666666666666666666666466666666666666666660666666666666666666656666666666666666666666666666666666666666666666466666666666666666661666666666666666666656666666666666666666666666666666666666666666666466666666666666666662666666666666666666656666666666666666666666666666666666666666666666466666666666666666663666666666666666666656666666666  !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!6666666666666666666666666666666666664666 666666666 66666 6666666666666666666566666666666666666666666666666666666666666666664#666666666666 6666$"666666666666666666656666666666Wart Version 2A(009) 14 Jan 92C-Kermit Protocol Module 5A(072), 18 Sep 94User cancelledUser cancelledSEND disabledCommand too long for serverCommand too long for serverCommand too long for serverCommand too long for serverRGET disabledBadly formed server commandREMOTE HOST disabledCan't do system commandQUIT disabledDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledCan't change directoryREMOTE CD disabledREMOTE DIRECTORY disabledAccess deniedCan't list directoryREMOTE DELETE disabledAccess deniedCan't remove fileFINISH disabledBYE disabledC-Kermit BYECan't send helpREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPE disabledAccess deniedCan't type fileREMOTE SPACE disabledAccess deniedCan't check spaceREMOTE WHO disabledCan't do who commandREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedBadly formed server commandQUIT disabledUnimplemented REMOTE commandCan't open windowCan't open windowXCan't open fileError writing dataXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedRESEND capabilities not negotiatedCan't execute commandCan't open file remote name:Can't send attributesCan't open windowDCan't open windowDCan't open fileUnknown errorckcpro.w sstate at E pktProtocol errorUnexpected packet typeSorry, you must 'set speed' firstfailed: proto ttopen localCan't open lineproto ttopen localCan't condition lineserver backgrdserver quietSHOULD NOT SEE THIS IF IN BACKGROUND!KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server done|m@Nm@ 7<774479? ???==>><@A<@<@D@D@@lAxDLDLDLDLDxDLDxDxDBBCC|EHI|E|EEElFHLdMLLLLLLCommand package 5A(067), 2 Oct 94Command? PROMPT sxPROMPT sy %spushcmd: savbuf:&cmpushcmpush: no memory for cmp&cmpop&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zpcmnum 2nd chknum okOutput filecmofi 1cmofi 1.5cmofi 2cmofi 3?Wildcards not allowed - %s cmofi 4cmofi 5: is directory/dev/ttycmofi 6: failure?Write permission denied - %s cmofi 7: okcmifi gtwordcmifi atxbuf?malloc error 73, cmifi cmifi svcmifi sv wild?No files match - %s ?Too many files match - %s cmifi sv not wild?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s ?No files match - %s ?Too many files match - %s cmifi partialcmifi partial k%scmifi partial cmdbufcmifi partial atmbuf/%s%ccmifi directory atmbuf%s Input file specification %scmifi ? *xp, cccmifi ? wild?No files match - %s ?Too many files match - %s , one of the following: %s%scmdir gtword Directory name %s %s%scmfld: gtwordcmfld xcmfld returns%s Please complete this field %s %s%scmtxt, cmflgscmtxt (*f)cmtxt: gtword xcmtxt calling (*f)cmtxt (*f) returns%s Text string %s %s%s?Unexpected return code from gtword() - %d cmkey: table length cmflgs zzcmkey: gtwordcmkey atxbuf after *f?Ambiguous - %s ?No keywords match - %s %s cmkey: defaultcmkey: esc?No keywords match - %s %s cmkey: addbuf No keywords match One of the following: %s, one of the following: %s or the token %c or one of the tokens: %s %s%s %d - Unexpected return code from gtword cmcfm: cmflgscmcfm: atmbuf?Not confirmed - %s ?Not confirmed - %s Type a carriage return to confirm the command %s%s %s ungword cmflgsgtword ungetting from ppgtword returning atmbufgtword: cmdbuf bp ppgtword EOF %s %s%s %s%sgtword quote?Command too long, maximum length: %d.  chknumL@@˃@Ճ@@Y@@ل@@Q@@@@@R@@ن@@Y@@@@/@v@@@@$@q@@ɉ@@Y@@@@>@@֋@@ @M@N@@ی@#@o@@@(@)@_@@@@@@@1@w@@@@>@@@@;@w@@@E@_@@@ܒ@ @&@A@v@@@ӓ@@7@{@@Ӕ@@(@C@e@@Õ@@@Q@@@@Ֆ@@7@i@@՗@@_@@Ř@@>@Y@@@ř@ٙ@@@$@2@;@G@N@V@@@@@;@@ԛ@@d@@@ @0@1@T@@@3@|@@՞@@@@ڟ@@J@@̠@@\@@@@@<@v@@Ģ@@W@@@0@v@@@J@@@ҥ@@@<@@ʦ@@U@@@@ϩ@B@O@@]@@@ @ @#@:@@ĭ@@@`@r@s@@خ@#@g@@@@@Q@@@0@x@@@J@h@i@@в@@_@@@@@7@Q@@@@F@f@@@ @T@@۶@@P@n@@@@-@O@@@!@9@@ʹ@ @#@g@r@s@@κ@@`@@@@@@d@@Ѽ@@Q@@˽@@1@{@@@@@e@@@#@n@@@@>@S@@@@T@@@@^@@@@@W@@@:@n@o@@@@@h@@@@@O@@@@@;@@@@*@`@@@)@u@@ @I@@@@E@@@@1@~@@@@@@&@s@@@@@@@@@U@V@@@2@b@c@@@@%@&@C@@@@#@=@>@d@@@@H@@@@@@]@@@@@>@@@@@7@@@ @6@d@r@@@D@@@@@+@?@U@V@{@@@,@r@@@@@@@4@5@`@@@%@&@Q@@@ @ @*@s@@@@`@r@s@@@@2@3@N@c@@@@@C@g@@@@ @ @i@@@F@@@@@@5@@@@N@O@h@@@B@N@g@@@@@@@@,@s@@@@ @m@@@@@d@@@@e e0ePehjeeeef0fffffPghjgghjhjh h@hfphhghhiXihixiihjiiijeg@efhj0ggfPfifPhhjdddg@ghj fhjhjii@fjhjhg`hhjefi8jhjhjhjipfgdhjpghjhjfhjhjhjhj ge0hhdhj(jhjhj`ghhHj`fXj@@@8AzAAA@AlAAA*AiAAAAAAfAAAA AWAAAAA&ArAAA AXAAAAMAAAA*A+AQAAA% AY AZ A A A A< Ag A A A A= Ay A A A A A? A A A A Ac A~ A A AAfAAA%A&AHAlAAAAgAAAAAFAAA%AAAAA ALAAAA=AAAAAPAQAtAAA AWAAAAA7AAAAA6AAAA^A_AAAAZAAAA!AlAAAAAA@AVAAA'A<AAAAAA:AOAAAA=AAAA A+ Ai Ax A A A A AF!A!A!A!A!"A6"Ay"A"A"A"A#A9#AN#A#A#A#A-$A_$Al$A$A$A$A%AC%AT%AU%Ah%A%A%A:&A&A&A&AA'A'A'A(A,(Axlllmo8mXmohmxmXlohlomoooono$noDnnTntnoonnnmknnnollommoo(lnldnllloHl8looonloo4n(mloomHm3A3A3A4Ac4A4Axoooooooohphphpohppphp(p8phpHpXp [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -d log debug info to debug.log -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory other: -C "command, command, ..." (interactive-mode commands to execute) = means ignore following words, but place them in array \&@[]. If no action command is included, or -S is, enter interactive dialog. Usage: Trustees of Columbia University in the City of New York. Type INTRO for a brief introduction to C-Kermit. Type VERSION for version and copyright information. Type HELP followed by a command name for help about a specific command. Type NEWS for news about new features. Type BUG to learn how to report bugs. Press ? (question mark) at the prompt, or anywhere within a command, for a menu (context-sensitive help, menu on demand). From system level, type "kermit -h" for help about command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,Digital Press / Butterworth-Heinemann, 1993, ISBN 1-55558-108-0. To order,call +1 212 854-3703 or +1 800 366-2665. Please purchase the documentation.It teaches you how to use C-Kermit and answers your questions; sales are aprimary source of funding for the Kermit effort. Also see the file CKCKER.UPD for new features in edits 189 and 190.Numerous features have been added to C-Kermit since "Using C-Kermit" waspublished. These include file transfer recovery, control-characterunprefixing for faster file transfer, Hebrew character-set support, newfunctions and variables, new IF conditions, command retry and recall, a newinterface to external protocols, and much more. All the changes and newfeatures are fully documented in the file CKCKER.UPD (C-Kermit Update) thatis distributed along with C-Kermit.Welcome to UNIX C-Kermit communications software for: . Error-free and efficient file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing While typing commands, you may use the following special characters: . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. . CTRL-W: Delete the most recent word typed. . CTRL-U: Delete the current line. . CTRL-R: Redisplay the current line. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-N: Command recall - go forward in command recall buffer. . ? (question mark) Display a menu for the current command field. . ESC (or TAB) Attempt to complete the current field. . \ (backslash) include the following character literally or introduce a backslash code, variable, or function. Command words other than filenames can be abbreviated in most contexts. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request general help HELP command request help about the given command TAKE execute commands from a file Commands for file transfer: SEND send files RESEND recover an interrupted file transfer RECEIVE receive files SERVER be a file transfer server Important settings: SET PARITY communications parity SET FLOW communications flow control, such as XON/XOFF SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET MODEM select modem type SET LINE select serial communication device SET SPEED select communication speed DIAL dial the phone number CONNECT begin terminal connection To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. To speed up file transfers: SET RECEIVE PACKET-LENGTH (use bigger packets) SET WINDOW (use sliding windows) SET CONTROL UNPREFIX (reduce prefixing overhead) For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: Kermit Distribution E-mail: Columbia University kermit@columbia.edu (Internet) 612 West 115th Street KERMIT@CUVMA (BITNET/EARN/CREN) New York, NY 10025 USA Phone: +1 212 854-3703 Fax: +1 212 663-8202Syntax: BYE Shut down and log out a remote Kermit serverSyntax: CLOSE nameExample: CLOSE PACKET Close one of the following logs or files: SESSION TRANSACTION PACKET DEBUGGING READ WRITEType HELP LOG and HELP OPEN for further info.Syntax: MINPUT n [ string1 [ string2 [ ... ] ] ]Example: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RING For use in script programs. Waits up to n seconds for any one of thestrings to arrive on the communication device. If no strings are given, thecommand waits for any character at all to arrive. Strings are separated byspaces; use { braces } for grouping. If any of the strings is encounteredwithin the timeout interval, the command succeeds and the \v(minput)variable is set to the number of the string that was matched: 1, 2, 3, etc.If none of the strings arrives, the command times out, fails, and\v(minput) is set to 0. Also see: INPUT, REINPUT, SET INPUT.Syntax: CONNECT (or C) [/QUIETLY] Connect to a remote computer via the serial communications device given inthe most recent SET LINE command, or to the network host named in the mostrecent SET HOST command. Type the escape character followed by C to getback to the C-Kermit prompt, or followed by ? for a list of CONNECT-modeescape commands. Include the /QUIETLY switch to suppress the informational message thattells you how to escape back, etc.Syntax: GET filespec Tell the remote Kermit server to send the named file or files. If the filespec is omitted, then you are prompted for the remote and local filenames separately.Syntax: LOG (or L) name [ { NEW, APPEND } ]Record information in a log file: DEBUGGING Debugging information, to help track down bugs in the C-Kermit program (default log name is debug.log). PACKETS Kermit packets, to help with protocol problems (packet.log)SESSION Terminal session, during CONNECT command (session.log)TRANSACTIONS Names and statistics about files transferred (transact.log) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created.Syntax: SCRIPT text Login to a remote system using the text provided. The login scriptis intended to operate similarly to uucp "L.sys" entries.A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and'send' is the names, numbers, etc, to return. The send may also be thekeyword EOT, to send control-d, or BREAK (or \\b), to send a break signal.Letters in send may be prefixed by ~ to send special characters. These are:~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don'tappend a return, and ~o[o[o]] for octal of a character. As with someuucp systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect,e.g. ~0 or two adjacent dashes, causes a short delay. If you expectthat a sequence might not arrive, as with uucp, conditional sequencesmay be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.Syntax: RECEIVE (or R) [filespec] Wait for a file to arrive from the other Kermit, which must be given aSEND command. If the optional filespec is given, the (first) incomingfile will be stored under that name, otherwise it will be stored underthe name it arrives with. If the filespec denotes a directory, theincoming file or files will be placed in that directory.Syntax: SEND (or S) filespec [name] Send the file or files specified by filespec. filespec may contain wildcard characters '*' or '?'. If no wildcards, then 'name' may be used to specify the name 'filespec' is sent under; if 'name' is omitted, the file is sent under its own name.Syntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.Syntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position.Syntax: MSEND filespec [ filespec [ ... ] ] Send the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. An alternate name cannot be given.Syntax: SERVER Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program. Use FINISH or BYE to get C-Kermit out of server mode.The SET command is used to establish various communication or fileparameters. The SHOW command can be used to display the values ofSET parameters. Help is available for each individual parameter;type HELP SET ? to see what's available.Syntax: SET KEY k textOr: SET KEY CLEAR Configure the key whose "scan code" is k to send the given text whenpressed during CONNECT mode. SET KEY CLEAR restores all the defaultkey mappings. If there is no text, the default key binding is restored forthe key k. To find out the scan code and mapping for a particular key, use theSHOW KEY command.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, orBLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3specify more rigorous checking at the cost of higher overhead. TheBLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain noblanks.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31, 127-159, 255.The word "ALL" means the command applies to all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL isrecommended for safety. You can include multiple values in onecommand, separated by spaces.SET DIAL DIAL-COMMAND [ text ]The 'text' replaces C-Kermit's built-in modem dialing command. It mustinclude '%s' (percent s) as a place-holder for the telephone numbersgiven in your DIAL commands. If the 'text' is omitted, C-Kermit uses itsbuilt-in modem-specific dialing command. SET DIAL DIRECTORY filenameName of dialing directory file. Type HELP DIAL for further info. SET DIAL DISPLAY {ON, OFF}Whether to display dialing progress on the screen. SET DIAL HANGUP {ON, OFF}Whether the DIAL command should hang up the phone before dialing. SET DIAL INIT-STRING [ text ]The 'text' is a replacement for C-Kermit's built-in initialization commandfor the modem. If 'text' omitted, use built-in initialization command. SET DIAL KERMIT-SPOOF {ON, OFF}If the selected modem type supports the Kermit protocol directly,use this command to turn its Kermit protocol function on or off. SET DIAL MODEM-HANGUP {ON, OFF}Governs how the HANGUP, H, and similar operations work when you havea dialed connection (in local mode, and a specific modem type is set).ON means to use modem commands to hang up the phone, e.g. ATH0.OFF means to hang up by attempting to turn off the DTR signal.ON is not necessarily supported for all modem types. SET DIAL MNP-ENABLE {ON, OFF}Enable or disable MNP negotiation by the modem. SET DIAL PREFIX [ text ]Establish a prefix to be applied to the phone numbers given in the DIALcommand or read from the dialing directory. SET DIAL SPEED-MATCHING {ON, OFF}ON (the default) means that C-Kermit changes its serial interface speed toagree with the speed reported by the modem's CONNECT message, if any. OFFmeans that C-Kermit should not change its interface speed. SET DIAL TIMEOUT numberHow many seconds to wait for a dialed call to complete. Use this commandto override the DIAL command's automatic timeout calculation. A valueof 0 turns off this feature and returns to Kermit's automatic dialtimeout calculation. Also see DIAL and SET MODEM. Use SHOW DIAL to display dial-relatedsettings. Syntax: SET FLOW value Type of flow control to use during file transfer and CONNECT mode.Choices: KEEP (don't change device's current setting), XON/XOFF (softwareflow control, the default), NONE (no flow control at all), and possiblyothers including RTS/CTS (hardware) depending on the capabilities of yourcomputer and operating system. Type SET FLOW ? for a list.Syntax: SET FILE parameter valueParameters: BYTESIZE { 7, 8 }: normally 8. If 7, truncate the 8th bit of all file bytes. COLLISION tells what to do when a file arrives that has the same name asan existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if it is newer than the existing file.Example: SET FILE COLLISION UPDATE SET FILE DISPLAY selects the format of the file transfer display forlocal-mode file transfer. The choices are: SERIAL (the default). One dot is printed for every K bytes transferred. This format works on any kind of terminal, even a hardcopy. CRT. Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. FULLSCREEN. A fully formatted 24x80 screen showing lots of information. This requires a video display terminal whose control sequences are understood by Kermit. NONE. No file transfer display at all. INCOMPLETE - what to do with an incompletely received file: DISCARD(default), or KEEP. NAMES are normally CONVERTED to 'common form' during transmission; LITERALmeans use filenames literally (useful between like systems). Also seeSET SEND PATHNAMES and SET RECEIVE PATHNAMES. TYPE: How file contents are to be treated during file transfer.TYPE is normally TEXT, with conversion of record format and character set.BINARY means to do no conversion. Use BINARY for executable programs orbinary data. Example: SET FILE TYPE BINARY. WARNING. SET FILE WARNING is superseded by the newer command, SET FILECOLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAMEand SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. Syntax: SET HANDSHAKE value Character to use for half duplex line turnaround handshake during filetransfer. C-Kermit waits for this character from the other computer beforesending its next packet. Default is NONE, others are XON, LF, BELL, ESC,etc. SET HANDSHAKE CODE lets you specify the numeric ASCII value of thehandshake character. Type SET HANDSH ? for a list.SET SERVER DISPLAY {ON,OFF}Tell whether local-mode C-Kermit during server operation should put afile transfer display on the screen. Default is OFF. SET SERVER TIMEOUT nServer command wait timeout interval, how often the C-Kermit server issuesa NAK while waiting for a command packet. Specify 0 for no NAKs at all.Default is 0.The REMOTE command is used to send file management instructions to aremote Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.Syntax: IF [NOT] condition command If the condition is (is not) true, do the command. Only one command maybe given, and it must appear on the same line as the IF. Conditions are: SUCCESS - the previous command succeeded FAILURE - the previous command failed BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground REMOTE-ONLY - C-Kermit was started with the -R command-line option DEFINED variablename or macroname - The named variable or macro is defined DIRECTORY string - The string is the name of a directory NEWER file1 file2 - The 1st file is newer than the 2nd one NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n1 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 > n1 n2 - n1 is arithmetically greater than n2 The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less See also XIF.Syntax: EVALUATE expression Evaluate an integer arithmetic expression and print its value. Theexpression can contain numbers and/or numeric-valued variables or functions.Operators include +-/*(), etc. Example: EVAL (1+1) * (\%a / 3).Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Extended IF command. The conditions are the same as for IF (type HELP IF)but multiple comma-separated commands may be grouped within braces in boththe IF and ELSE parts. The ELSE part, if any, must be on the same line asthe XIF (or use dash for line continuation). Example: XIF equal \%a YES { echo OK, goto begin } ELSE { echo Not OK, stop }Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist thenumber of times given by the initial value, final value and increment.Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketedcommandlist while the condition is true. Conditions are the same as forIF commands.Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specifiedmode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or writeto a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename [ prompt ]Example: ASKQ \%p { Password:} Issues the prompt and defines the variable to be whatever you type in.The characters that you type do not echo on the screen.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: ASK variablename [ prompt ]Example: ASK \%n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: GETC variablename [ prompt ]Example: GETC \%c { Type any character to continue...} Issues the prompt and sets the variable to the first character you type.Use braces to preserve leading and/or trailing spaces in the prompt.Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally.No expansion or evaluation of the definition is done. Thus if thedefinition includes any variable or function references, their names areincluded, rather than their values (compare with ASSIGN). If the definitionis omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro).The definition string is fully evaluated before it is assigned, so thatthe values of any variables are contained are used, rather than theirnames. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This will print 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current valueis numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value isnumeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: SET EXIT STATUS number Set C-Kermit's program return code to the given number, which can be a constant, variable, or an \feval() expression. Syntax: SET EXIT WARNING { ON, OFF } When EXIT WARNING is ON, issue a warning message and ask for confirmation before EXITing if a connection to another computer might still be open. Default is OFF.Syntax: PAUSE [ number ]Example: PAUSE 3 Do nothing for the specified number of seconds; if no number given, onesecond. If interrupted from the keyboard, set FAILURE, otherwise SUCCESS.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given,100 milliseconds.Syntax: ! [ command ] or RUN [ command ] or PUSH [ command ] Give a command to the local operating system's command processor, anddisplay the results on the screen. If the command is omitted, enter interactive mode; return to Kermitby exiting from the system's command parser. The command is usuallyEXIT or QUIT or LOGOUT.Syntax: TRANSMIT file The TRANSMIT command is used for sending single files to other computersthat don't have Kermit. Text files are sent a line at a time; binary filesare sent a character at a time. There is no guarantee that the othercomputer will receive the file correctly and completely. Before you startthe TRANSMIT command, you must put the other computer in data collectionmode, for example by starting a text editor. TRANSMIT may be interrupted byCtrl-C. Synonym: XMIT.Syntax: WAIT number [modem-signal(s)]Example: WAIT 5 \cd\cts Waits up to the given number of seconds for all of the specified signals.Sets FAILURE if signals do not appear in given time or if interrupted bytyping anything at the keyboard during the waiting period. Signals: \cd = Carrier Detect, \dsr = Dataset Ready, \cts = Clear To SendSyntax: WRITE name text Writes the given text to the named log or file. The text text may includebackslash codes, and is not terminated by a newline unless you include theappropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGSyntax: DIAL phonenumberExample: DIAL 7654321 Dial a number using an autodial modem. First you must SET MODEM, thenSET LINE, then SET SPEED. Then give the DIAL command, including the phonenumber, for example: DIAL 7654321 See also SET DIAL, SET MODEM, SET LINE, SET SPEED, REDIAL. The 'phonenumber' can also the name of an entry from your dialing directory,which is a plain text file, one entry per line: name phonenumber speed parity comments for example: e-mail 765-4321 2400 even My electronic mailbox The fields are separated by spaces, and all fields after the 'phonenumber'are optional. If the speed or parity are present, they replace your currentSET SPEED and SET PARITY settings. Specify your dialing directory file withthe SET DIAL DIRECTORY command.DOHELP xxSyntax: APC text Echoes the text in the form of a VT220/320/420 Application Program Command. Use the APC command to send commands to MS-DOS Kermit 3.13 or later.Describes how to report C-Kermit bugs.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: CLEAR [ { DEVICE, INPUT, BOTH } ] Clears the communications device input buffer, the INPUT command buffer, or both. The default is BOTH.Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: CD [ directoryname ] Change Working Directory, equivalent to UNIX cd command.Syntax: DECLARE arrayname[size] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables.Syntax: DELETE filespec Delete a local file or files. RM is a synonym for DELETE.Syntax: DIRECTORY [ filespec ] Display a directory listing of local files.Syntax: DISABLE command Security for the C-Kermit server. Prevent the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Execute a macro that was defined by the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1, \%2, etc.Syntax: ECHO text Display the text on the screen, followed by a newline. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: ENABLE capability For use with server mode. Allow the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exit from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: ERROR Send an Error packet to the other Kermit to get it out of packet mode.Syntax: QUIT (or EXIT) Exit from the Kermit program, closing all open files and devices.Syntax: FINISH Tell the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Print the prompt, make user type 'yes', 'no', or 'ok', and set SUCCESS or FAILURE accordingly.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1994,Give a brief introduction to C-Kermit.Syntax: INPUT n [ text ] Example: INPUT 5 Login: Wait up to n seconds for the given text to arrive on the communication line. If no text, waits for any character. For use in script programs with IF FAILURE and IF SUCCESS. Also see MINPUT, REINPUT, SET INPUT.Redial the number given in the most recent DIAL commnd.Syntax: REINPUT n string Look for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Change the name of file 'oldname' to 'newname'.Introduce a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Send the file to the remote Kermit, which must be in RECEIVE or SERVER mode, and request that the remote host deliver the file as electronic mail to the given address. Example: MAIL BUG.TXT KERMIT@CUVMA Print news of new features since publication of "Using C-Kermit".Syntax: OUTPUT text Send the text out the currently selected line, as if you had typed it during CONNECT mode. The text may contain backslash codes. Example: OUTPUT help\13Syntax: PRINT file [ options ] Print the local file on a local printer with the given options.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Read a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with with \fexecute(macro), which allows macros to be used like functions.Syntax: SUSPEND or Z Suspend Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET yDisplay current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TYPE file Display a file on the screen. Pauses if you type Ctrl-S, resumes if you type Ctrl-Q, returns immediately to C-Kermit prompt if you type Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Sorry, help not available for "%s" %s %s Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command, used for uploading filesto computers that don't have Kermit programs. Parameters are: ECHO ON/OFF: Whether to echo text as it is being transmitted.EOF text: Text to send after end of file is reached.FILL number: ASCII value of character to insert into blank lines.LINEFEED ON/OFF: Transmit LF as well as CR at the end of each line. Normally, only CR is sent.LOCKING-SHIFT ON/OFF: Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.PAUSE number: How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).PROMPT number: ASCII value of character to look for from host before sending next line, normally LF (10).Synonym: SET XMIT.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screeneven though Kermit thinks it is running in the background.Syntax: SET BUFFERS n1 [ n2 ] Change the overall amount of memory allocated for SEND and RECEIVE packetbuffers, respectively. Bigger numbers let you have longer packets and morewindow slots. If n2 is omitted, the same value as n1 is used.Syntax: SET COMMAND parameter value SET COMMAND BYTESIZE { 7, 8 } Informs C-Kermit of the bytesize of the communication path between itself and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow entry and display of 8-bit characters. SET COMMAND RECALL-BUFFER-SIZE number How big you want C-Kermit's command recall buffer to be. By default, it holds 10 commands. You can make it any size you like, subject to memory constraints of the computer. A size of 0 disables command recall. Whenever you give this command, previous command history is lost. SET COMMAND QUOTING { ON, OFF } Whether to treat backslash and question mark as special characters (ON), or as ordinary data characters (OFF) in commands. ON by default. SET COMMAND RETRY { ON, OFF } Whether to reprompt you with the correct but incomplete portion of a syntactically incorrect command. ON by default.Syntax: SET CARRIER ON, AUTO, or OFF Attempts to control treatment of carrier on the communication device.ON means that carrier is required at all times except during the DIALcommand. OFF means that carrier is never required. AUTO (the default)means that carrier is required only during CONNECT.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission ofselected file attributes along with each file, and to handle or ignoreselected incoming file attributes, including: DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET INPUT parameter value The SET INPUT command controls the behavior of the INPUT command: SET INPUT CASE { IGNORE, OBSERVE }Tells whether alphabetic case is to be significant in string comparisons.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files. SET INPUT ECHO { ON, OFF }Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUTcommand times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT }Tells whether to proceed or quit from a script program if an INPUT commandfails. PROCEED (default) allows use of IF SUCCESS and IF FAILURE commands.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files.Syntax: SET TAKE parameter value Controls behavior of TAKE command. SET TAKE ECHO { ON, OFF } tells whether commands read from a TAKE fileshould be displayed on the screen. SET TAKE ERROR { ON, OFF } tells whether a TAKE command file should beautomatically terminated when a command fails. This setting is local tothe current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter value SET TERMINAL APC { ON, OFF, UNCHECKED }controls execution of Application Program Commands sent by the host whileC-Kermit is in CONNECT mode. ON allows execution of "safe" commands anddisallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, andRUN. OFF prevents execution of APCs. UNCHECKED allows execution of allAPCs. OFF is the default. SET TERMINAL BYTESIZE 7 or 8, to use 7- or 8-bit terminal charactersbetween C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } to specify how incomingcarriage return characters are to be displayed on your screen. SET TERMINAL DEBUG { ON, OFF } controls terminal session debugging. SET TERMINAL ECHO { LOCAL, REMOTE } specifies which side does the echoingduring terminal connection. SET TERMINAL LOCKING-SHIFT { OFF, ON } tells C-Kermit whether to useShift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bitcharacters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } tells whether to send CRLF when youtype CR during CONNECT mode. Type SHOW TERMINAL to see current terminal settings.Syntax: SET MACRO parameter value Controls the behavior of macros. SET MACRO ECHO { ON, OFF } tells whether commands executed from a macrodefinition should be displayed on the screen. SET MACRO ERROR { ON, OFF } tells whether a macro should be automaticallyterminated upon a command error. This setting is local to the currentmacro, and inherited by subordinate macros.Syntax: SET MODEM-DIALER name Type of modem for dialing remote connections. Selects the dialing protocol,such as HAYES, to be used by the DIAL command. Many modem dialing protocolsare supported; type SET MODEM ? for a list. DIRECT or NONE means a directconnection, with no modem at all. Also see HELP DIAL, HELP SET CARRIER.Syntax: SET PROMPT [ text ] Prompt text for this program, normally 'C-Kermit>'. May contain backslashcodes for special effects. Surround by { } to preserve leading or trailingspaces. If text omitted, prompt reverts to C-Kermit>. Prompt can includevariables like \v(dir) or \v(time) to show current directory or time.Syntax: SET WINDOW-SIZE number Specify number of window slots for sliding windows, the number of packetsthat can be transmitted before pausing for acknowledgement. The defaultis one, the maximum is 31. Increased window size may result in reducedmaximum packet length. Use sliding windows for improved efficiency onconnections with long delays. A full duplex connection is required.Syntax: SET REPEAT { COUNTS { ON, OFF }, PREFIX } SET REPEAT COUNTS turns the repeat-count compression mechanism ON and OFF. The default is ON.SET REPEAT PREFIX sets the repeat-count prefix character to the given code. The default is 126 (tilde).Syntax: SET RECEIVE parameter value Specify parameters for inbound packets: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit receives, normally 35 (number sign). Don't change this unless something is wrong with the other Kermit program.END-OF-PACKET number ASCII value of control character that terminates incoming packets, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet the other Kermit should send.PADDING number Number of prepacket padding characters to ask for (normally 0).PAD-CHARACTER number ASCII value of control character to use for padding (normally 0).PATHNAMES ON or OFF If a recognizable path (directory, device, etc) specification appears in an incoming filename, leave it ON and try to use it, or strip it OFF before trying to create the output file. When ON (the default), then if any of the directories in the path don't exist, C-Kermit tries to create them.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character that marks start of inbound packet.TIMEOUT number Number of seconds other Kermit should wait for a packet before sending NAK or retransmitting.Syntax: SET SEND parameter value Specify parameters for outbound packets. This command should be used onlyto override the normal negotiated parameters and is rarely needed: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit sends, normally 35 (number sign).END-OF-PACKET number ASCII value of control character to terminate an outbound packet, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet to send, even if other Kermit asks for longer ones.PADDING number Number of prepacket padding characters to send.PAD-CHARACTER number ASCII value of control character to use for padding.PATHNAMES ON or OFF When FILE NAMES is set to LITERAL, leave the path (device, directory, etc) portion ON or OFF the file name when sending it. Applies to the actual filename, not the "as-name". The default is ON.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character to mark start of outbound packet.TIMEOUT number Number of seconds to wait for a packet before sending NAK or retransmitting.Synonym: SET XFER Syntax: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] OFF disables remote-mode packet-mode cancellation from the keyboard.ON enables it. The optional is the control character to use forcancellation; the optional is how many consecutive occurrencesof the given control character are required for cancellation. Syntax: SET TRANSFER LOCKING-SHIFT { OFF, ON, FORCED } Tell whether locking-shift protocol should be used during file transferto achieve 8-bit transparency on a 7-bit connection. ON means to requestits use if PARITY is not NONE and to use it if the other Kermit agrees,OFF means not to use it, FORCED means to use it even if the other Kermitdoes not agree.Syntax: SET CASE { ON, OFF } Tells whether alphabetic case is significant in string comparisons done by INPUT, IF, and other commands. This setting is local to the current macro or command file, and inherited by subordinates.Syntax: SET INCOMPLETE { DISCARD, KEEP } Discard or Keep incompletely received files, default is DISCARD.Syntax: SET COUNT number Example: SET COUNT 5 Set up a loop counter, for use with IF COUNT. Local to current macro or command file, inherited by subordinate macros and command files.Syntax: SET DEBUG { SESSION, ON, OFF } SESSION means display control and 8-bit characters symbolically during CONNECT mode. ON means log debugging information to file debug.log.Syntax: SET DEFAULT directory Change directory. Equivalent to CD command.Syntax: SET DELAY number Number of seconds to wait before sending first packet after SEND command.Syntax: SET SUSPEND { OFF, ON } Disables SUSPEND command, suspend signals, and Z during CONNECT.Syntax: SET SCRIPT ECHO { OFF, ON } Disables/Enables echoing of SCRIPT command operation.Syntax: SET DUPLEX { FULL, HALF } During CONNECT: FULL means remote host echoes, HALF means C-Kermit does its own echoing.Syntax: SET LOCAL-ECHO { OFF, ON } During CONNECT: OFF means remote host echoes, ON means C-Kermit does its own echoing. Synonym for SET DUPLEX { FULL, HALF }.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt.Syntax: SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character. Syntax: SET LINE devicename or: SET PORT devicename Select communication device to use. Normally %s. If you SET LINE to other than %s, then Kermit will be in 'local' mode; SET LINE alone will reset Kermit to remote mode. To use the modem to dial out, first SET MODEM-DIALER (e.g., to HAYES), then SET LINE xxx, next issue the DIAL command, and finally CONNECT. Syntax: SET PARITY name Parity to use during terminal connection and file transfer: EVEN, ODD, MARK, SPACE, or NONE. Normally NONE.Syntax: SET QUIET {ON, OFF} Normally OFF. ON disables most information messages during interactive operation.Syntax: SET RETRY number How many times to retransmit a particular packet before giving up.Syntax: SET SESSION-LOG { BINARY, TEXT } If BINARY, record all CONNECT characters in session log. If TEXT, strip out carriage returns.Syntax: SET SPEED number Communication line speed for external tty line specified in most recent SET LINE command, in bits per second. Type SET SPEED ? for a list of possible speeds.Syntax: SET WILDCARD-EXPANSION { KERMIT, SHELL } KERMIT (the default) means C-Kermit expands filename wildcards in SEND and MSEND commands and incoming GET commands. SHELL means your shell does it.Not available yet - %s Syntax: REMOTE SET parameter valueExample: REMOTE SET FILE TYPE BINARY Ask the remote Kermit server to set the named parameter to the given value.Equivalent to typing the corresponding SET command directly to the otherKermit if it were in interactive mode.Syntax: REMOTE CD [ name ] Ask remote Kermit server to change its working directory or device. If the device or directory name is omitted, restore the default.Syntax: REMOTE DELETE filespec Ask the remote Kermit server to delete the named file(s).Syntax: REMOTE DIRECTORY [ filespec ] Ask the remote Kermit server to provide a directory listing of the named file(s) or if no file specification is given, of all files in the current directory.Syntax: REMOTE HELP Ask the remote Kermit server to list the services it provides.Syntax: REMOTE HOST command Send a command to the remote host computer in its own command language through the remote Kermit server.Syntax: REMOTE KERMIT command Send a command to the remote Kermit server in its own command language.Syntax: REMOTE LOGIN user password [ account ] Log in to a remote Kermit server that requires you login.Syntax: REMOTE LOGOUT Log out from a remote Kermit server to which you have previously logged in.Syntax: REMOTE PRINT filespec [ options ] Send the specified file(s) to the remote Kermit and ask it to have the file printed on the remote system's printer, using any specified options.Syntax: REMOTE SPACE [ name ] Ask the remote Kermit server to tell you about its disk space on the current disk or directory, or in the one that you name.Syntax: REMOTE TYPE file Ask the remote Kermit server to type the named file(s) on your screen.Syntax: REMOTE WHO [ name ] Ask the remote Kermit server to list who's logged in, or to give information about the named user.Syntax: REMOTE QUERY { KERMIT, SYSTEM, USER } variable-name Ask the remote Kermit server to send the value of the named variable of the given type, and make it available in the \v(query) variable.Syntax: REMOTE ASSIGN variable-name [ value ] Assign the given value to the named global variable on the server.not working yet - %s lAAuAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAxAAAAAAAAAAAAhAAAAAAAA<AABABA BABABA BA &BA.BA9BA?BADBALBA QBAVBA_BAdBAiBA lBApBA sBAxBA}BABABABABABABAeBAmBABAoBAsBABABABABABABABABABABABABABACACA CACACA#CA6CAMaximum retries per packet10?Retry limit must be greater than window size %d403%dinterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs %d404echotype of filetext ?Speed cannot be set for network connections Transmission rate for %s in bits per second?value required ?Sorry, you must SET LINE first ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, %ld bps character-setASCII code for cancellation character3Cancel character must be in ASCII control range How many required to cause cancellation2Number must be 2 or greater onwho expands wildcardskermitNumber of sliding-window slots, 1 to 321%d406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterpacingMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listSET CONTROL atmbufallala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. repeat-count compression parameter(not implemented yet, nothing happens) ASCII value?Illegal value for prefix character Not working yet - %s A network connection to %s might still be active. A serial connection might still be active on %s. OK to close? OK to exit? Please respond Yes or No control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d ^A^A^A^A^A^A^A^A^A^A^A^A^A^A_A_A_A _A_ArA_A_A _A&_A/_A9_A,>_A0I_AO_A&S_AW_A\_A`_Aj_A$u_A8~_A _A_A_A)_A_A_A_A!_A"_A _A_A_A/_A7_A_A_A+_A_A#_A `A `A4`A `A-`A$`A+`A11`A 8`A.A`AH`AM`AS`A0[`Ae`Aj`As`Ax`A`A`A `A`A`A`A`A`A`A`A`A`A `A `A`A `A`A`A`AaA aAaA؟8$8pȿ 400\D ,8 Da ,|lH4X|8Haaaa\xx,aaHaaT`JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSatargcargscmdfilecmdlevelcmdsourcecolsconnectioncountcpscpudatedaydirectorydialstatusevaluateexitstatusfilespecfsizeftypehomehostinputincharincountlinelocalmacrominputmodemndatendaynewlinentimeparityplatformprogramqueryreturnrowsspeedstatussysidsystemterminaltfsizetimettyfdversioncharactercodecontentsdatedefinitionevaluateexecutefilesindexlengthliterallowerlpadmaximumminimimnextfilereprepeatreplacereverserightrpadsizesubstringupperappendnewcmdini: no memory for kermrc.kermrcprescan argdebug.logmissing name in -ynonenone?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... transmit char?Can't transmit character transmit bufCan't send buffer Name of debugging log filedebug.logName of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.log ?Unknown log designator - %d ?Sorry, %s is a directory name DispositionnewTransaction Log:Debug Log Communications Parameters: Host: %s Line: %s, speed: unknown75/1200%ld, mode: localremote, modem: %s, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Named Pipes, telnet protocol Terminal bits: %d, p Parity: %s, duplex: half, full, flow: keepxon/xoffnonenonerts/ctsnonedtr/ctsnonedtr/cd%d, handshake: %d none offonautounknown Carrier: %s, timeout: %d sec, timeout: none, lockfile: %s Escape character: %d (^%c) No networks are supported in this version of C-Kermit (none) \{%d} Dial directory: %s (none) Dial hangup: %s, dial modem-hangup: %s onoffonoff Dial kermit-spoof: %sonoff, dial display: %s onoff Dial speed-matching: %sonoff, dial mnp-enable: %s onoff Dial init-string: Dial dial-command: Dial prefix: Dial timeout: %d sec0 (auto), Redial number: %s (none) File parameters: Attributes: onoff Names: %-12sconvertedliteral Debugging Log: %snone Type: textbinary?%-12s Packet Log: none Longest filename: %d Collide: %-12sunknown Session Log: none Longest pathname: %d Send Pathnames: %soff on Receive Pathnames: %s offon Display: %-12snone%-12sserial%-12sfullscreen%-12scrt Transaction Log: none Byte Size: %d, Incomplete: keepdiscard, Init file: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Server Timeout:%4d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' Packet Length:%11d %8d Repeat Prefix: '%c' Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced %senableddisabled,%s%s not used %s,%s Most recent transaction -- files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) 8th bit prefixing : yes [%c] no locking shifts : %s yesno window slots used : %d of %d packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %d sec transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps efficiency (percent) : %d apc_commands?Can't condition line for INPUT doinput doinput timodoinput echoinput rtinput ttinc(rt) returnsinput coninc(rt) returnsdoinput charcompare charinput interrupted from keyboarddoreinput?malloc error 6 doreinp charcompare charfnevalfnevalfneval function argfneval malloc failure, argfneval xxstring fails, argfneval argfneval arg post evalfneval evaluated argfexec pushed too deep ?\fexec() too deeply nested %d00%d0%d%d%d%s%ld%d%d%dunknownUNIX%ld%d%ld%s/%dunknown%ld%dC-Kermit%ld%ldi386%d%d10promptmacrofileunknown%dnoneevenmarkoddspaceunknown%d%ld0textbinaryimagelabeledmacbinaryunknown 2480TERM%sunknown%dremoteserialunknownU1?definition is circular or too deep xxstringxxstring r2xxstring function namexxstring r2 before freexxstring function argxxstring freeing r2xxstring vnameP8tAtA/uATuAuAuAuA&vA'vAKvAqvAvAvAvAvA(wA)wA|||pL݁AAP  Ph h  \ ,HH`$\(8"L"x"x"x"!x"x"x"x" "Aset parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1_assign _for\v(cmdlevel) { _getargs,define \\\%1 \%2,:top,if \%5 \\\%1 \%3 goto bot,\%6,:inc,incr \\\%1 \%4,goto top,:bot,_putargs},def break goto bot, def continue goto inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:inc,\%1,\%2,goto inc,:bot,_putargs},_def break goto bot, _def continue goto inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)cmdini: no memory for keymapcmdini: no memory for macrotabCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for kermrccmdini: no memory for termcap buffercmdini: no memory for linecmdini: no memory for tmpbufcmdini: no memory for apcbufCan't allocate macro buffers!C-Kermit>ibm-linemodefatal_forx_xif_while\&@[%d]\&@[%d]/ini file isropen okinit filegetncm dest lengthnext cmdgetncm eom%s getncm returns ptr todomac entry maclvldomac loop maclvl 1domac loop maclvl 2domac loop exit maclvlgetnctgetnct malloc failure%sLine from TAKE filegetnct nlgetnct bad lineWarning: Last line of TAKE file lacks terminator getnct igetnct lp2?Command too long, maximum length: %d. Trailing commentComment trimmed & terminatedLast char in lineLine is continuedtmpdir restoring&parser entry maclvl&parser entry inlevel&parser entry tlevel&parser entry cmdlvl&parser entry mtop of parse loopAPC ttchk p1tlevelCommand file terminated by error. Command error: macro terminated. parser macroparser maclvlcmdbuf from macro?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersparser top of while loopCommandtop-level cmkey2top-level cmkey token ?Invalid - %s docmd returnscmdbufatmbuf?Invalid: %s top-level cmkey failedKermit command error in background execution%sparser preparing to continueparser breaks out of while loopxxout obsizexxout pacingxxout stringdooutput sdooutputOUTPUT NULOUTPUT BREAKOUTPUT Long BREAKdooutputOUTPUT error herald%s, for%s Copyright (C) 1985, 1994, Trustees of Columbia University in the City of New York. Type ? or HELP for help. addmmac lineaddmmac linesaddmmac loop exitaddmmac length?addmmac malloc error: %s addmmac malloc erroraddmmac constructed stringaddmmac length mismatch !addmmac internal error! addmac namaddmac def(null pointer)addmac def?addmac malloc error 2 addmac paddmac p(null pointer)addmac numeric global maclvladdmac macro arg maclvladdmac globaladdmac macro error 7: %s addmac macro defaddmac table sizeaddmac table overflowaddmac position?addmac malloc error 3: %s ?addmac malloc error 5: %s delmac namdelmac defdelmac def(null pointer)delman defdelmac def(null pointer)delmac mlookpopclvl beforepopclvl after ?Debugging log wasn't open ?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open ?Unexpected log designator - %d disabledenabledonoff Versions: %s Numeric: %ld-%d %s for%s %s %s for%s %s %s %s %s %s %s %s %s Special features: RESEND command Fullscreen file transfer display Control-character unprefixing Features not included: No network support No hardware flow control No character-set translation No REDIRECT command None Compiler options: DEBUGTLOGXFRCANCK_SPEEDCK_APCCK_MKDIRDYNAMICCMDDEP=%dUNIXDIRENTCK_TMPDIRCK_NEED_SIGCK_TTYFDHDBUUCPNOKVERBSI386IXATTSVSVR3i386SVR3JCCK_CURSESCK_WREFRESHCK_PCT_BARDCMDBUFCK_RECALL Key code \%d => String: \{%d} Character: \%u%c \%u (self, no translation) Press key: ?Error reading key Macro name, or carriage return to see them all%s - not found Macros: %d Function Status: GET %s SEND %s REMOTE CD/CWD %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s Server timeout: %d Server display: %s %s SUCCESSFAILURE Command bytesize: %d bits Terminal bytesize: %d bits TERM Terminal type: %s (unknown) Terminal echo: %s localremote Terminal locking-shift: %s Terminal newline-mode: %s Terminal cr-display: %s crlfnormal Terminal debug: %s onoffunchecked Terminal APC: %s SESSION LOG ACTIVE: %s CONNECT-mode escape character: %d (Ctrl-%c, %s) DEL Suspend: %s The following functions are available: \F() \v(%s) = \{%d} \{%d} %s %s Global variables: \%%%c No variables defined Macro arguments at level %d \%%%d = %s No macro arguments at top level Declared arrays: \&%c[%d] No arrays declared Cancellation: %s %d %d Send / Receive Pause: %d (msec) Command Quoting: %s Take Echo: %s Take Error: %s Macro Echo: %s Macro Error: %s Input Case: %s ObserveIgnore Input Echo: %s Input Silence: %d (seconds) Input Timeout: %s quitproceed Output Pacing: %d (milliseconds) Script Echo: %s File type: %s binarytext Terminal echo: %s localremote Transmit EOF: none ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: none Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: none Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d milliseconds Escape character: Ctrl-%c (ASCII %d, %s) DEL, speed: unknown 75/1200 %ld offonautounknown Carrier: %s, timeout: %d sec, timeout: none %s modem signals: Character set translation is not supported in this version of C-Kermit EXIT WARNING %s ONOFF Current EXIT status: %d Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s onoff Command quoting: %s Suspend: %s Nothing to show... Line: %s, Modem: Communication device not yet selected with SET LINE Modem: couriercourier or sportster%s (%s) %s = (null definition)Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s invalid digit '%c' in number Invalid character '%c' in input +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript must be numeric - %s ?Array dimension or subscript must be positive or zero - %s ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range %dxwords macrododo maclvldodo maclvl too deepMacros nested too deeply do macrododo cmdlvl too deep?TAKE files and DO commands nested too deeply do macro%0\flit(Name of local directory, or carriage return?Wildcards not allowed in directory name %s %s %sԔAהA۔AߔAAAAAAA AA AAA A*A0A6Abackgroundcountdefineddirectoryequalerrorexistfailureforegroundlltlgtnewernotoknumericremote-onlysuccessVariable name?Variable name required ?Read file not open read zsinlread addmacPrompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).{ Yes or no? }Please respond Yes or No getc addmacPlease respond. cmtxt ask addmacVariable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required dodef successdodefDefinition of variablexxdef var namexxdef var def?Argument vector array is read-only Definition of array elementxxdef array refxxdef array defDefinition of macroxxdef macro namexxdef macro defcalling addmac?%s failed ASSIGNDEFINEludial pass %s not in %s ludial failsludial From dialing directory %s: %s=%s (number missing) Can't set speed to %s ?No DIAL command given yet Number to dial or entry from dial directoryNumber to dial?You must specify a number to dial ?Dialing directory "%s" entry lacks phone number Directory/file specificationDIR fs_copyCK_DIR%s %sDIRFile(s) to delete?A file specification is required xxdel tmpbuf%s %sxxdel line%s - %sdeleted not ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _forx initial valuefinal valueincrement1%d Command to execute?Unbalanced brackets ?Zero increment not allowed _forx_forx_forx?FOR macro definition gone! FOR command?Incomplete FOR command %s,%s Numeric: %ld-%d Before deciding you have found a bug, please consult the documentation: . "Using C-Kermit" . The CKCKER.BWR file . The CKUKER.BWR file To report C-Kermit bugs, send e-mail to: kermit@columbia.edu (Internet) KERMIT@CUVMA (EARN/CREN/BITNET) ...!uunet!columbia.edu!kermit (Usenet) Or write to: Kermit Development Columbia University 612 W 115 Street New York, NY 10025 USA Or call: +1 212 854-5126 (USA) Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. seconds to wait1seconds to pause1milliseconds to sleep100modem signalFile to rename?Name of existing file required ?Please specify a single file New name?New name for file required dorename linedorename p?Can't rename %s to %s ?Can't return from level %d RETURN parseRETURN maclvl 1_xif_for_whiRETURN poppingRETURN maclvl 2RETURN maclvl 3RETURN copymode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file ?Read file already open System command to read from?Command name required ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedCommand file ends prematurely in multiline GET OofaRemote filename missing in multiline GET MupeenMacro definition ends prematurely in multiline GET OofaRemote filename missing in multiline GET Mupeen Remote file specification: Name of remote file(s) cmtxt(cancelled) Local name to store it under: Local file name(cancelled) xxget cmargxxget fspecRECEIVE arg disk or dirtmpdir savingtmpdir changing?Can't access %s ?Can't get current directory _getargs maclvl_putargs maclvlsuccess_getarg p(null pointer)_getarg p_putarg m_arg[maclvl+2][i]_putarg m_arg[maclvl+2][i](null pointer)_get/putarg exit_get/putarg exit maclvlgoto cxgoto cmdlvlgoto maclvlgoto tlevelgoto before conversiongoto after conversion?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro goto in macromacro GOTO labelmacro target labelgoto failed at cmdlvl?Label '%s' not found goto found macro labelgoto failed at cmdlvl?Label '%s' not found ?Stack problem in GOTO %s ?Condition required if successif failureMacro or variable nameIF DEFif definedif countFileDirectory name?File or directory name required if exist 1if directory 1if directory 2first word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long IF EQ string 1, xIF EQ string 2, yIF EQ strcmpIF EQ xxstrcmpfirst number or variable name?Quantity required xxifgt cmfldxxifgt exp1countversionargcsecond number or variable name?Quantity required xxifgt exp2countversionargcxxifft ifcxxifft n1xxifft n2xxifft zvariable name or constant?Quantity required xxifnu cmfldxxifnu quantityxxifnu chknumFirst fileSecond file?Failure to get file date xxifnewer d1xxifnewer d2xxifnewerIF conditiondoif: pushing command command to be ignoredObject commandelse_xif_xif_xif?XIF macro gone! { \flit(if not goto bot) } WHILE cmdObject commandWHILE body_while_while_while?WHILE macro definition gone! WHILE dodo?Can't allocate storage for WHILE commandrFailure to open?TAKE files and/or DO commands nested too deeply PAVA]AbAhAoAtAG{AKASAGA A AAAAͰAذA A AA AA AAA(A.A5A Size: %ld, Type: Size: unknown, Type: labeledimagebinary undefinedbinarytext File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld [OK] [discarded] [interrupted] [skipped]Error: Refused: [incomplete]*** screen() called with bad status ***%s: %ld*** screen() called with bad object ***ermsgProtocol Error:Transaction Log Closedon_exitdoexit exitstatdoexit whatC-Kermit EXIT status(NULL)(NULL)(string too long)(string too long)%s%s:%c %s%s:^%c %s%s:~^%c %s%s:~%c %s%s:%ld =%ld [%s] [%s]=%ld %s=%ld %s[%s] %s[%s]=%ld ?Invalid format for debug() - %d %ld%c%c%ld%sLABELEDIMAGEBINARY UNDEFINEDBINARY / partial / resend / resendTEXT%02ld:%02ld:%02ldscreenc cinitscreenc cendwscreen calling initscrscreen initscr okscreenc calling clearscreenc clear okscreenc setup okscreenc doing first movescreenc myhostscreenc myhost%s, %s%sCurrent Directory: %sNetwork Host: %sCommunication Device: %sNetwork Type: Communication Speed: (network)75/1200%ldunknownParity: %sFile Type:File Size:Percent Done: ...10...20...30...40...50...60...70...80...90..100Estimated Time Left:Transfer Rate, CPS:Window Slots:Packet Type:Packet Count:Packet Length:Packet Retry Count:Last Error:Last Message:<%s>X to cancel file, <%s>Z to cancel group, <%s> to resend last packet<%s>E to send Error packet, ^C to quit immediately, <%s>L to refresh screen.SCREENC switchResending:Sending:Receiving:File Name:%.55s..%s => %s => %.51s.. => %s%ld%s%d%d%d of %d%d%cDamaged PacketTimeoutTransfer OKFile discardedTransfer interruptedFile skipped%sRefused, %sRefusedIncomplete*** screen() called with bad status ***%ldFiles: %ld, Total Bytes: %ld, Efficiency: %d%% Elapsed Time: %s? %s%s*** screen() called with bad function code ***0LLL@LLLLLLLLLLLLLLLLLLLLLb$D0L<4Ll\lL@4cmdlinxargvinvalid command-line option, type "kermit -h" for helpaction-l or -j or -X required-a without -s, -r, or -gwrite access to -a file deniedcan't change to -a directoryunredirected -k can only be used in local modedoarg entrydoarg argNo commands given for -Cinvalid argument bundlingmissing delay valuebad delay valueconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -s-No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedconflicting actionsinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missing/dev/ttycan't open devicecmdlin speedinvalid argument bundlingmissing bpsunsupported transmission rateinvalid argument bundling after -mmodem type missingunknown modem typeinvalid argument bundling after -emissing lengthUnsupported packet lengthinvalid argument bundlingmissing or bad window sizeUnsupported packet lengthinvalid argument bundlingmissing parityinvalid parityinvalid command-line option, type "kermit -h" for helpTA rAuAwA*yA.{A}A_A7A5A6A7AQAAA&AA\AAA*AAAGAGA;AAA(AA A2 AOA A<A@$A0(Ah1A 4A 9A*AA CA JAHMAHQAiYA]A _A bA fAgkAVqA/vA+}AAA-AA9AA[AAAAAAdA A]APAPA]APAA^AADAAA0AAf AAAA3A"A$AE)A1AS8A8@AGANA&UAe\ACcAfAjAlA)sAxAAA AA!A!A!AA"A1ANA$A4A%A&A?A>AIA'AAAAAAAAAaAa AJA%ANAX AY(AT1AU!#;:@:A=A@ADA"OA3QA3TA3_AdApA2xA.A7A6A6AA6AA'AAAA4AA0AAAEAA A A A A A "A*&A(A-A@8A+>AKADRAYA^AeA?kA sAzAAAAA#A1AA<A(A!A%A/A;A$A/:AAAAA AAA"A'A.A4A;A AAEAKAOAUAZA^AhApAxAAAAAAAAAA AAAA AA A*A6AFAQA[AbAmA|A"AAAA"AAAAAAA AAAAAAAAAA"A *A 1A 8AAA JATA]A "bAfAiAmAtAxA{AA AAAAAAA A A A Ahp ph@@User Interface 5A(156), 4 Oct 94!#:@apcasgaskaskqassignbugbyeccatcdcheckclearclosecommentconnectcwddcldeclaredecrementdefinedeletedialdirectorydisabledoe-packetechoelseenableendevaluateexexitextprocffinishfoforforwardfotggegetgetcgetokgotohanguphelpiifinincrementinputintroductionlloglsmailmanminputmgetmpausemsmsendmsleepmputmvnewsoopenoutputpausepopprintpsendpupushputpwdquitrreadreceiveredialreinputremoterenamereplayresendreturnrmrunsscriptsendserversetshowsleepspspaspacespawnstatisticsstopsuspendtaketesttransmittypeversionwaitwhilewhowrwriwritwritewrite-linewritelnxifxmitz_assign_define_getargs_putargsnookyesattributesbbabackgroundbaudblock-checkbufferscarriercasecmdcommandconconsolecontrol-charactercountddedebugdefaultdelaydialduplexescape-characterexitfileflow-controlhandshakeincompleteiininputkeyllinelocal-echomacromodem-dialeroutputparityportpromptquietreceiverepeatretry-limitscriptsendserversession-logspeedsuspendtaketerminaltransfertransmitwildcard-expansionwindow-sizexmitasasgassigncdcwddeletedirectoryhelphostkermitloginlogoutprintpwdquerysetspacetypewhodebuggingpacketssessiontransactionsappend-filedebug-logerrorfilepacket-logscreensession-logsys$outputtransaction-logbothdevice-bufferinput-bufferappend-filedebug-logpacket-logread-filesession-logtransaction-logwrite-fileargumentsarraysattributescharacter-setscmdcomcommcommunicationscommandcontrol-prefixingcountddefaultdialescapeexitfeaturesfilefunctionsglobalskkeymacrosmodem-signalsparametersprotocolscriptsserverstatusterminaltransmitvariablesversionsxmitallasasgassignbyecdcwddeletedirectoryfinishgethostquerysendsetspacetypewho/quietlydocmd entry, cx docmd XXGTAdocmd cxdocmd XXGTA maclvldocmd dogta returnsdocmd dogta maclvlbuffer(s) to clearbothText of comment lineCarriage return to confirm, or optionWhich log or file to close?You must say which file or log Integer arithmetic expression%s Array name?Array name required ?Declare failed Server function to enableServer function to disable?Name of server function required optional return valueoptional return value ?No macros defined macro?Macro name required optional argumentsText to be echoedApplication Program Command text%c_%s%c\%s Text to be outputOUTPUT 1OUTPUT 2OUTPUT 3OUTPUT sizeOUTPUT 4File to print?A file specification is required ?Wildcards not allowed Local print command options, or carriage returnexit status codeName of remote file(s), or carriage returnC-Kermit commandhelpHELP command xtop-level cmkey token ?Invalid - %s label?Label name required %dseconds to wait for inputList of input stringsMINPUT cmfld returns?Memory allocation failure MINPUTMaterial to be input?Memory allocation failure xxrei line?INPUT timed out ?MINPUT timed out ?REINPUT failed label?Label name required What to log?Type of log required expect-send expect-send ... Name under which to store the (first) incoming file, or: name of directory in which to store all the file(s), or: confirm the command now to store the files in the current directory under their own names.RECEIVE arg disk or dirtmpdir savingtmpdir changing?Can't access %s ?Can't get current directory cmofi cmarg2Remote Kermit server command?You must specify a command for the remote server ?Sorry, FILE TYPE must be BINARY or IMAGE ?Sorry, ATTRIBUTE DISPOSITION must be ON File(s) to send?A file specification is required ?Sorry, wildcards not permitted in this command ?Sorry, this command needs 32-bit integers starting position (byte number)Send: wildName to send it withSending: as:?Disposition Attribute is Off Mail: wildAddress to mail to?Address required ?Option string too long Mailing:To:Names of files to send, separated by spaces?A file specification is required ?MSEND list too long msfiles Parameter?You must specify a parameter to set ?More fields required System command to executeRUN zshcmd codeparametersConfirm for current disk, or specify a disk device or directory%s %sexit status code0Message to print%s END maclvl 1_xif_for_whiEND poppingEND maclvl 2END maclvl 3?Take files nested too deeply C-Kermit command file?A file name is required ?Wildcards not allowed in command file name File to transmit?Name of an existing file ?Only a single file may be transmitted calling transmitFile to type?Name of an existing file ?A single file please CK_TYPE%s %sTYPEcmdlvl = %d, tlevel = %d, maclvl = %d %s Call me from inside a macro and I'll dump the argument stackMacro level: %d, ARGC = %d %7d %2d: %7s(none) %s, for%s Numeric: %ld-%d user nameCK_WHO%s %sto file or log?Write to what? text%s%s ?Write error ?File or log not open docmd unk argDA0BBBB B6BVBgBBBBBBB<BBBCONNECT Command for UNIX, 5A(073) 15 Sep 94APC beginAPC terminatedforkint - CK_FORK_SIGck_sndmsg - notifying parentck_sndmsg - returningpipeint argpipeint codepipeint duplexAPC at parentCKCPUTC obcCKCGETC 1 ibcCKCGETC 1 calling ttinc(0)CKCGETC 1 ttinc(0)CKCGETC 2 ibckbget errnoCONNECT fork signalSorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated ckucon entry ttyfdckucon entry ibcckucon entry obcckucon entry kbcckucon entry ttchkckucon openingSorry, can't open %sckucon open failureConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. (Session logged to %s, %s) binarytextDebugging Display...) Sorry, can't condition console terminal CONNECT cmaskCONNECT cmdmskCONNECT speed before ttvtCONNECT ttvtSorry, can't reopen %sSorry, Can't condition communication line CONNECT ttvt ok, escapeescseqCONNECT newforkCan't make pipeCan't make port fork Communications disconnect (Back at %s) local UNIX system CONNECT keyboard fork duplexkmptr non NULLmacro empty, continuingchar from macro** KEYBCONNECT keyboard read errnoCONNECT got escape Can't send characterCONNECT signaling port forkCONNECT killing port forkCONNECT killed port fork(Back at %s)local UNIX system ?setuid error - fatal CONNECT starting port forkCONNECT port fork ibcCONNECT port fork obcCONNECT disconnect ibcCONNECT disconnect obc Communications disconnect Can't read character** PORTAPC completeAPC complete ibcAPC complete obcckucon exit ibcckucon exit obc ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK H to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. Press C to return to the C-Kermit prompt, or:Command>doesc Hanging up Connected %s %stothrough, speed %ldTerminal bytesize: %d, Command bytesize: %d, Parity: noneevenoddspacemarkTerminal echo: %slocalremoteLogging to: Error resuming CONNECT session ERROR WRITING SESSION LOG, LOG CLOSED!BBBBBBBBBBBBBBB#B(B)B*B.B/B0B2B4B5B6B7B=B>B?B@BABBBCBDBHBIB(JB MBNBRBSBTB[B\B]BdBlBmBnBwBxByB{B~BBBBBBBBBBBBBBBBBBB(B BBBBBLBBk BBBBBBBB#BBBBBBLBBk2BB,BBBBBB#B B2BBBBLBBBB B!B"B&B'B(B*B5B9B:BLBBFBkNBPB,TBVBYBjBnBoB#pBrBuB{B|BBBBBBBBBB<BBBBBBBB#BBdBBBBB#BBBBBBLBBk<BBdBBBBPLBBk Bt B B BT B B B Bl B B B BL B B B B,BdBBB B4 BB#B*B3B;BHBQBYBaBiBvBBBB B B BBBB BB BBB BB B)B5BAB45d55|<|<|<f<|<|<<<<<0g0g<<<<<<<<<dg=<<====== h h== h h =><>0=p?\C\RC>DETE|EE\RTE@GG\RFk :%s Kk *D ?%s %s ,ATQ0S2=43 OK ATTD%s +++ATQ0H0 % $K Number to call: %s , CDS >%s MODIFY?CALL %s ,!@ !d%s ,ATQ0S2=43X4&M4 OK ATD%s +++ATQ0H0 ,AAAAATQ0X1S12=50 S2=43 I OK ATD%s +++ATQ0H0 attdtdmattisnattmodematt7300ccitt-v25biscermetekconcordcourierdf03-acdf100-seriesdf200-seriesdigitel-dt22directgdc-212a/edgendatacommhayeshst-couriermicrocomnonepenrilpep-telebitracalvadicrolmslow-telebitsportstertelebitunknownusrobotics-212av32-telebitv42-telebitventeldialtime caught SIGALRMdialint caught SIGINTddinc entry n%s dial waitfor gotdidweget in Warning: speed change to %ld failed. Speed changed to %ld. ATI3 tbati3 failstbati3 rbufT1600T3000WorldVersion BTBSATBRMDCT1500ckudial dialfailDIAL Failure: %s: Timed out while trying to initialize modem. DIAL TIMEOUT interval expired. Timeout. dialtimeoutInterrupted. dialinterruptedCall not completed. Modem message: "" dialError initializing modem. dialmodem initSorry, DIAL memory buffer can't be allocated Please SET HOST first, and then SET MODEM Sorry, you must SET MODEM first Sorry, you must SET LINE or SET HOST first /dev/nullSorry, you must SET SPEED first dial numberdial prefix%sDIAL lbuf malloc ok%sDIAL rbuf malloc ok%sDIAL fbuf malloc okDIAL prefix + phone number too long! %s%sprefixed numberSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again Number: %s Via modem server: %s, modem-dialer: %s (unknown) Device: %s, modem-dialer: %s(unknown), speed: %ld , speed: (unknown) Dial timeout: %d seconds To cancel: type your interrupt character (normally Ctrl-C). ckdialckdial timeoutckdial dialhup failedSorry, Can't hang up communication device Try 'set line %s' again Initializing: %s... No response from modem, retrying%s... againckdial wake_str mdmstatATS7=%d%cckdial S7 mdmstatckdial telebit init string No response from modem, retrying%s... again962961963972968966967964969970965971123960Telebit modelTelebit model: %s ATS7=%d S48=%d S50=0 S58=2 S68=255 ATS7=%d S48=%d S50=0 S68=255 ckdial Telebit init step 2 No response from modem, retrying%s... againATS54=3 ATX2 S61=0 S63=0 ckdial Telebit init step 3 No response from modem, retrying%s... againckdial Telebit init step 3 skippedS50=0 S95=2 S97=1 S98=3 S106=1S180=2V.42 not supported by this Telebit model S95=2S95=0S180=3S180=0standardS50=0 S110=1S50=0 S190=1 S191=7S50=0300/1200/2400 BaudS50=3V.32S50=6V.32 not supported by this Telebit model. PEPS50=255 S190=1 S191=7S50=255 S110=1S50=255PEP not supported by this Telebit model. Kermit SpoofAT%s %s S111=%d S112=%d AT%s %s No Kermit SpoofKermit Spoof not supported by Qblazer No Kermit SpoofAT%s %s %s S111=0ckdial Telebit configckdial Telebit init step 4 No response from modem, retrying%s... againckdial telebit init mdmstatckdial Telebit augmdmtypckdial microcom ttslowckdial microcom waitforckdial microcom waitfor doneAPM1 APM0 ckdial default, wake stringckdial no wake_strckdial default, waiting for wake_promptckdial no wake_promptckdial got wake promptAT&M4&K1 AT&M0&K0 DIAL command + phone number too long! dialing Dialing: %s... ckdial old alarmckdial waitct No Connectiondial awaiting response, augmdmtypckdial modem responseBusyNot connectedNot ConnectedNo dial toneNo Dial ToneNo answerNo AnswerAnsweredConnectedANSWEREDBUSYDISCONNECTNO ANSWERWRONG ADDRESSANSWEREDBUSYCHECK OPTIONSDISCONNECTEDDENIEDVALWarning: No Carrier CNXINVINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callAU 1 ANERAttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:)ON LINENO CONNECTCONNECT Can't change speed to %ld Speed changed to %ld CONNECT FAST/KERMFAST/KERM RRINGRINGINGDIALINGCONNECTNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICERINGERROROKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDABANDONDEDNOT AVAILABLELACKS PERMISSIONNOT A DATALINEINVALID DATA LINE NUMBERINVALID GROUP NAMEBUSYDOES NOT ANSWERONLINE!Online!BUSYBusyDEAD PHONEINITIATINGBUSYCALL FAILEDNO CONNECTBUSYNO DIALTONECOMMAND ERRORIN USECONNECTdial df03 gotRESPONSE mdmechoSPONGERESPONSE-ARESPONSE-Cdial hayesnv lbufdial hayesnv gotdial hayesnv numericdial hayesnv suffix Local phone is ringing! No Carrier. Modem Command Error. No Dialtone. Busy. No Answer. CONNECT 1200/75 - Not support by C-Kermit Ringing... Dialing... No Prompttone. RELIABLELAPM COMPRESSED ckdial alarm offdial succeeded Call complete: %s. Call complete. getok entry nGETOK rbuf malloc okgetok alarm okgetok timeoutVALgetok rbuf init okgetok ddincgetok:OK ERROR at atMDMECHO-t AT ATMDMECHO-Tgetok returnsdialhup mdmhup Modem hangup OK Warning: modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped mdmhup no hup_strmdmhup hup_strmdmhup esc_strmdmhup esc_timemdmhup pause 1 OKmdmhup ttslow okmdmhup pause 1 OKmdmhup ttflui OKmdmhup ttslow okmdmhup calling response functionmdmhup hangup responsemdmhup no ok_fnl/BScript Command, 5A(023) 4 Oct 94expecting sequencegot it (null sequence)recvseqreceived sequence: returning with got-it codesending sequence EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. SCRIPT string: Sorry, Can't condition communication line Script successful. Script successful.Sorry, script failed Script failed1BNetwork support, 5A(039) 30 Sep 94@1BSVR32Kn,X` %K @1BBBЪBB#$" !+,&unknownTERMTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/.LINESCOLUMNS !"#$       n ijk    l+,opmq/.r0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab&5   %)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}y+#-( !"#$%&'(,$- 5B5B5B5B5B6BC6BX6B/usr/lib/terminfo is unaccessibleI don't know anything about your "%s" terminalcorrupted terminfo entryterminfo entry too longTERMINFO pathname for device exceeds 512 charactersmalloc returned NULLterminfo file for "%s" terminal is not readableSorry, . 8=B;=B>=BA=BD=BG=BJ=BM=BP=BS=BV=BY=B\=B_=Bb=Be=Bh=Bk=Bn=Bq=Bt=Bw=Bz=B}=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B=B>B>B>B >B >B>B>B>B>B>B>B">B%>B(>B+>B.>B1>B4>B7>B:>B=>B@>BC>BF>BI>BL>BO>BR>BU>BX>B[>B^>Ba>Bd>Bg>Bj>Bm>Bp>Bs>Bv>By>B|>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B?B?B?B ?B ?B?B?B?B?B?B?B!?B$?B'?B*?B-?B0?B3?B6?B9?B@BA@BD@BG@BJ@BM@BP@BS@BV@BY@B\@B_@Bb@Be@Bh@Bk@Bn@Bq@Bt@Bw@Bz@B}@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@B@BABABAB AB ABABABABABABAB"AB%AB(AB+AB.AB1AB4AB7AB:AB=AB@ABCABFABIABLABOABRABUABXAB[AB^ABaABdABgABjABmABpABsABvAByAB|ABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABABBBBBBB BB BBBBBBBBBBBBBB!BB$BB'BBbwamxbxsxneognhckmhsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGcoitlilmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@7@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%d%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZy̴̴̴̴̴̴̴̴̴̴̴Ttԭ (DH`p`$x (ج4(бFBFB0GBI don't know how to deal with your "%s" terminalI need to know a more specific terminal type than "%s"malloc returned NULLSorry, . 5MS7) `*a:f'g#o-q-s_x|~o,<+>.v-^h#i#0#4   liorkp/dev/ttyDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/pwd/dev/null/etc/utmp/etc/passwdrr: /bin/shsh-c@Unknown errorHOBPOBZOBtOBOBOBOBOBOBOBOBPB(PB9PBKPBWPBmPByPBPBPBPBPBPBPBPBPBQBQB-QBEQBRQBhQBwQBQBQBQBQBQBQBRBRB+RBDRBaRB|RBRBRBRBRBRBRBRBSB'SBTBNTB\TBxTBTBTBTBTBTBTBTBTBTBTBUB2UBYUB~UBUBUBVB VBVBVB'VB0VB9VBBVBKVBTVB]VBfVBoVByVBVBVBVBVBVBVBVBVBVBVBVBVBVBWBWBWB#WB-WB7WBAWBKWBUWB_WBiWBsWB}WBWBWBWBWBWBWBWBWBWBWBXBXBXB.XBFXBError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesResource temporarily unavailableNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageError 78Error 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Error 89Error 90Error 91Error 92Error 93Error 94Error 95Error 96Error 97Error 98Error 99Error 100Error 101Error 102Error 103Error 104Error 105Error 106Error 107Error 108Error 109Error 110Error 111Error 112Error 113Error 114Error 115Error 116Error 117Error 118Error 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileremote i/o errorreserved for future useError 142YBYBI I  <   h  0123456789,+-### $L$GMTGMTTZ/etc/utmp/dev/ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASSascii/lib/chrclass/̸B̸B,_BԸB@(#)crt1.o: INTERACTIVE UNIX System, Software Development System Version 4.1@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)setjmp.h 2.10 - 90/08/07@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)param.h 2.4 - 90/05/24@(#)s5param.h 2.4 - 90/11/13@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)setjmp.h 2.10 - 90/08/07@(#)file.h 2.7 - 94/03/21@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)ioctl.h 2.3 - 88/05/27@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)stream.h 2.3 - 88/05/27@(#)ptem.h 2.4 - 93/10/26@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)pwd.h 2.16 - 94/04/04@(#)time.h 2.19 - 93/01/21@(#)stat.h 2.24 - 94/04/04@(#)file.h 2.7 - 94/03/21@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)setjmp.h 2.10 - 90/08/07@(#)utsname.h 2.12 - 94/04/04@(#)curses.ed 2.4 - 94/09/27@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)setjmp.h 2.10 - 90/08/07@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)setjmp.h 2.10 - 90/08/07@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)setjmp.h 2.10 - 90/08/07@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)types.h 2.20 - 94/02/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)_wclear.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)_werase.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)curses.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)endwin.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)initscr.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)mvcur.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)newscreen.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)newwin.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)outch.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)printw.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)varargs.h 2.3 - 88/05/27@(#)reset_sh.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)setupterm.c 2.5 - 94/04/11@(#)jioctl.h 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)uparm.h 2.3 - 88/05/27@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)termcap.ed 2.3 - 88/05/04@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)termerr.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)tinputfd.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)tparm.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)tputs.c 2.3 - 88/05/27@(#)ctype.h 2.11 - 91/02/05@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)tstp.c 2.3 - 88/05/27@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)ttimeout.c 2.4 - 91/02/21@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)typeahead.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)vidupdate.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)vwprintw.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)varargs.h 2.3 - 88/05/27@(#)wclrtobot.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wclrtoeol.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wmove.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wrefresh.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wsyncup.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wtouchln.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)_waddstr.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)cbreak.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)chkinput.c 2.4 - 89/09/21@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)curserr.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)delay.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)delscreen.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)delterm.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)delwin.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)doupdate.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)init_acs.c 2.5 - 93/04/20@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)init_costs.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)makenew.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)memSset.c 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)tcsearch.c 2.3 - 88/05/27@(#)waddnstr.c 2.4 - 89/09/21@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wnoutref.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wsyncdown.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)delkeymap.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)waddch.c 2.4 - 89/09/21@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)wscrl.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)winsdelln.c 2.3 - 88/05/27@(#)curses_inc.h 2.3 - 88/05/27@(#)curses.ed 2.4 - 94/09/27@(#)stdio.h 2.24 - 94/03/23@(#)termio.h 2.3 - 88/05/27@(#)termio.h 2.9 - 94/05/06@(#)unctrl.h 2.3 - 88/05/27@(#)maketerm.ed 2.3 - 88/05/03@(#)curshdr.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)unctrl.h 2.3 - 88/05/27@(#)abort.c 3.5 - 94/03/24@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)atol.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)ctype.h 2.11 - 91/02/05@(#)chdir.s 3.4 - 94/01/20@(#)ctermid.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)ctime.c 3.3 - 88/05/27@(#)time.h 2.19 - 93/01/21@(#)types.h 2.20 - 94/02/14@(#)chmod.s 3.4 - 94/01/20@(#)dup.s 3.4 - 94/01/20@(#)fread.c 3.6 - 91/04/15@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)stdiom.h 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)getcwd.c 3.9 - 93/08/25@(#)stdio.h 2.24 - 94/03/23@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)getegid.s 3.4 - 94/01/20@(#)geteuid.s 3.4 - 94/01/20@(#)getgid.s 3.4 - 94/01/20@(#)fseek.c 3.6 - 91/03/25@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)atoi.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)ctype.h 2.11 - 91/02/05@(#)getlogin.c 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)utmp.h 2.3 - 88/05/27@(#)fputs.c 3.8 - 91/04/05@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)stdiom.h 3.3 - 88/05/27@(#)getppid.s 3.4 - 94/01/20@(#)getpwnam.c 3.3 - 88/05/27@(#)pwd.h 2.16 - 94/04/04@(#)getpwuid.c 3.4 - 90/11/09@(#)pwd.h 2.16 - 94/04/04@(#)getpwent.c 3.3 - 88/05/27@(#)param.h 2.4 - 90/05/24@(#)s5param.h 2.4 - 90/11/13@(#)stdio.h 2.24 - 94/03/23@(#)pwd.h 2.16 - 94/04/04@(#)fgets.c 3.6 - 91/04/15@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)stdiom.h 3.3 - 88/05/27@(#)getuid.s 3.4 - 94/01/20@(#)calloc.c 3.6 - 90/11/27@(#)shlib.h 3.4 - 91/01/04@(#)link.s 3.4 - 94/01/20@(#)mkdir.s 3.4 - 94/01/20@(#)creat.s 3.4 - 94/01/20@(#)pause.s 3.4 - 94/01/20@(#)perror.c 3.5 - 94/03/19@(#)string.h 2.15 - 94/02/19@(#)unistd.h 1.2 - 89/05/09@(#)unistd.h 2.26 - 94/04/04@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)popen.c 3.7 - 94/03/19@(#)stdio.h 2.24 - 94/03/23@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)limits.h 2.14 - 89/07/21@(#)limits.h 1.14 - 94/02/14@(#)fdopen.c 3.7 - 94/02/08@(#)stdio.h 2.24 - 94/03/23@(#)errno.h 2.12 - 90/08/08@(#)pipe.s 3.4 - 94/01/20@(#)printf.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)varargs.h 2.3 - 88/05/27@(#)fprintf.c 3.5 - 90/11/13@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)varargs.h 2.3 - 88/05/27@(#)memccpy.c 3.3 - 88/05/27@(#)rew.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)scanf.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)varargs.h 2.3 - 88/05/27@(#)doscan.c 3.12 - 91/04/15@(#)stdio.h 2.24 - 94/03/23@(#)ctype.h 2.11 - 91/02/05@(#)varargs.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)string.h 2.15 - 94/02/19@(#)atof.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)ctype.h 2.11 - 91/02/05@(#)values.h 2.4 - 90/12/14@(#)filbuf.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)ptod.c 3.6 - 91/01/04@(#)shlib.h 3.4 - 91/01/04@(#)math.h 2.14 - 91/06/05@(#)values.h 2.4 - 90/12/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)infini_def.c 1.4 - 93/01/29@(#)spec 2.6 - 91/10/07@(#)infinity.c 1.2 - 92/04/02@(#)isxpg_def.c 1.3 - 92/04/02@(#)spec 2.6 - 91/10/07@(#)isxpg.c 1.2 - 92/04/02@(#)setbuf.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)setgid.s 3.4 - 94/01/20@(#)setjmp.s 3.4 - 94/01/20@(#)setuid.s 3.4 - 94/01/20@(#)setvbuf.c 3.5 - 90/11/02@(#)stdio.h 2.24 - 94/03/23@(#)sleep.c 3.4 - 94/03/14@(#)signal.h 2.8 - 89/07/14@(#)signal.h 2.22 - 94/04/04@(#)param.h 2.4 - 90/05/24@(#)s5param.h 2.4 - 90/11/13@(#)times.h 2.13 - 91/06/21@(#)alarm.s 3.4 - 94/01/20@(#)sprintf.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)varargs.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)strcmp.s 3.4 - 94/01/20@(#)strerror.c 1.1 - 94/03/19@(#)string.h 2.15 - 94/02/19@(#)errlst.c 3.9 - 94/03/19@(#)ldexp.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)values.h 2.4 - 90/12/14@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)strtol.c 3.9 - 91/02/15@(#)ctype.h 2.11 - 91/02/05@(#)execl.s 3.4 - 94/01/20@(#)execv.s 3.4 - 94/01/20@(#)execve.s 3.4 - 94/01/20@(#)exit.s 3.4 - 94/01/20@(#)fork.s 3.4 - 94/01/20@(#)time.s 3.4 - 94/01/20@(#)time_comm.c 3.21 - 94/05/04@(#)string.h 2.15 - 94/02/19@(#)ctype.h 2.11 - 91/02/05@(#)stdlib.h 1.8 - 94/04/04@(#)types.h 2.20 - 94/02/14@(#)time.h 2.19 - 93/01/21@(#)strchr.c 3.3 - 88/05/27@(#)strncpy.c 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)times.s 3.4 - 94/01/20@(#)fopen.c 3.6 - 94/01/14@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)findiop.c 3.4 - 91/01/31@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)access.s 3.4 - 94/01/20@(#)tolower.c 3.3 - 88/05/27@(#)ctype.h 2.11 - 91/02/05@(#)toupper.c 3.3 - 88/05/27@(#)ctype.h 2.11 - 91/02/05@(#)fcntl.s 3.4 - 94/01/20@(#)ttyslot.c 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)utmp.h 2.3 - 88/05/27@(#)strncmp.c 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)strrchr.c 3.3 - 88/05/27@(#)ttyname.c 3.5 - 89/05/15@(#)types.h 2.20 - 94/02/14@(#)stat.h 2.24 - 94/04/04@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)string.h 2.15 - 94/02/19@(#)stdio.h 2.24 - 94/03/23@(#)closedir.c 3.7 - 90/11/13@(#)types.h 2.20 - 94/02/14@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)opendir.c 3.6 - 91/03/01@(#)types.h 2.20 - 94/02/14@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)stat.h 2.24 - 94/04/04@(#)errno.h 2.12 - 90/08/08@(#)fstat.s 3.4 - 94/01/20@(#)malloc.c 3.11 - 91/06/03@(#)shlib.h 3.4 - 91/01/04@(#)values.h 2.4 - 90/12/14@(#)assert.h 2.8 - 90/08/07@(#)readdir.c 3.6 - 90/11/13@(#)errno.h 2.12 - 90/08/08@(#)types.h 2.20 - 94/02/14@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)getdents.s 3.4 - 94/01/20@(#)sbrk.s 3.4 - 94/01/20@(#)seekdir.c 3.4 - 89/10/03@(#)types.h 2.20 - 94/02/14@(#)dirent.h 2.10 - 89/07/13@(#)dirent.h 2.10 - 90/08/20@(#)lseek.s 3.4 - 94/01/20@(#)stat.s 3.4 - 94/01/20@(#)strcat.c 3.3 - 88/05/27@(#)ulimit.s 3.4 - 94/01/20@(#)uname.s 3.4 - 94/01/20@(#)ungetc.c 3.5 - 94/04/20@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)unlink.s 3.4 - 94/01/20@(#)utime.s 3.4 - 94/01/20@(#)vsprintf.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)varargs.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)doprnt.c 3.17 - 94/05/10@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)string.h 2.15 - 94/02/19@(#)ctype.h 2.11 - 91/02/05@(#)varargs.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)nan.h 2.3 - 88/05/27@(#)print.h 3.3 - 88/05/27@(#)ctype_def.c 3.3 - 88/05/27@(#)spec 2.6 - 91/10/07@(#)ctype.c 3.8 - 91/03/13@(#)fcntl.h 2.5 - 89/05/09@(#)fcntl.h 2.18 - 93/03/22@(#)types.h 2.20 - 94/02/14@(#)ctype.h 2.11 - 91/02/05@(#)ecvt.c 3.4 - 91/01/24@(#)shlib.h 3.4 - 91/01/04@(#)math.h 2.14 - 91/06/05@(#)nan.h 2.3 - 88/05/27@(#)values.h 2.4 - 90/12/14@(#)dtop.c 3.4 - 91/01/04@(#)shlib.h 3.4 - 91/01/04@(#)errno.h 2.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)math.h 2.14 - 91/06/05@(#)values.h 2.4 - 90/12/14@(#)biglitpow.s 3.4 - 94/01/20@(#)frexp.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)nan.h 2.3 - 88/05/27@(#)fpreal.s 3.4 - 94/07/29@(#)fwrite.c 3.7 - 90/11/13@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)stdiom.h 3.3 - 88/05/27@(#)types.h 2.20 - 94/02/14@(#)flsbuf.c 3.10 - 91/04/19@(#)shlib.h 3.4 - 91/01/04@(#)stdio.h 2.24 - 94/03/23@(#)stdiom.h 3.3 - 88/05/27@(#)errno.h 2.12 - 90/08/08@(#)close.s 3.4 - 94/01/20@(#)getenv.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)isatty.c 3.3 - 88/05/27@(#)shlib.h 3.4 - 91/01/04@(#)termio.h 2.9 - 94/05/06@(#)i386_data.s 3.4 - 94/01/20@(#)ioctl.s 3.4 - 94/01/20@(#)ltostr.c 3.3 - 88/05/27@(#)memchr.c 3.3 - 88/05/27@(#)memcpy.s 3.4 - 94/01/20@(#)memset.c 3.3 - 88/05/27@(#)open.s 3.4 - 94/01/20@(#)read.s 3.4 - 94/01/20@(#)stdio_def.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)spec 2.6 - 91/10/07@(#)data.c 3.3 - 88/05/27@(#)stdio.h 2.24 - 94/03/23@(#)strcpy.s 3.4 - 94/01/20@(#)strlen.s 3.4 - 94/01/20@(#)wait.s 3.4 - 94/01/20@(#)write.s 3.4 - 94/01/20@(#)signal.s 3.9 - 94/04/04@(#)kill.s 3.4 - 94/01/20@(#)getpid.s 3.4 - 94/01/20@(#)cerror.s 3.4 - 94/07/29@(#)gen_def.c 3.3 - 88/05/27@(#)spec 2.6 - 91/10/07@(#)mall_def.c 3.3 - 88/05/27@(#)spec 2.6 - 91/10/07@(#)free_def.c 3.3 - 88/05/27@(#)spec 2.6 - 91/10/07@(#)cuexit.s 3.5 - 94/08/03@(#)fakexhand.s 1.1 - 94/07/29@(#)mall_data.s 3.4 - 94/01/20@(#)crtn.o: INTERACTIVE UNIX System, Software Development System Version 4.1/shlib/libc_s