,PP @ @ @ھ 08h5t> @   5t$h$PP @6/mnt@`dT 08h5t$ @   5t$h$PP @Y@`dT U5t> @6 U(h"bA 5t%5t<X;5t<X;p˰2A5t% 5t+(5t+(iw#Q'A5t9 5t95t9 LAtA5t%W5t;25t;2kkA5t%W5t%W5t%WlzA5t%W5t%W5t%>mklA5t%>5t-55t-5n A5t%>5t<I5t<IoA5t%ׄ5t%95t%tq'A5t%G5t.1xˀ5t.1xˀr| ]A5t<G5t>5t>sD!mA5t%G5t/ 5t/ t%A5t%95t%95t%tu*tzA5t%95t:À5t:Àv?I%5t& 5t)5t-5xҒt5t.À5t.À5t.ÀwLJP5t. h5t. !5t. ! @ibY 5t.v5t.v5t.v Aa5t.>5t.>5t.> BZ y5t.e5t.e5t.e C5t.$[܀5t.$[܀5t.$[܀ D]z5t.*T5t.*T5t.*T Ed5t.1xˀ5t.1xˀ5t.1xˀ FQ5t.8ـ5t.8ـ5t.8ـ G)5t/5t/5t/ Hoz5t/ 5t/ 5t/ Iw lm25t/)'5t/+5t/+ P X ` JFRI!5t0+5t0+5t0+N !5t0/q5t0/q5t03B !5t05 R5t05 R5t1 XoUq!5t1N5t1N5t1WMC*!5t1p5t1p5t1tۧU!5t185t185t1e !5t1 /5t1 /5t1( N!5t1*Q5t1*Q5t1,F!5t1.}5t1.}5t16!5t18ـ5t18ـ5t1:i!5t25t25t2!5t2Ĵ5t2Ĵ5t2w)7!5t2X;5t2X;5t2 T!B5t2(5t2(5t2/q 5}BB!B5t298p5t298p5t3 FSB!B5t3 5t3 5t3f B!B5t3e5t3e5t3$[܀ B!5t3&65t3&65t3(Q!!5t3*Q5t3*Q5t3, # !5t3.}5t3.}5t30G5n!5t37n5t37n5t4 XwS+b!5t395t395t4 XwƲjJ!5t45t45t4 Xw AW!5t4À5t4À5t4 XwW!5t45t45t4 wڤ*a5t43B5t43B5t5ׄwa5t48C5t48C5t5ׄca5t55t55t5ׄ,:!5t5Ĵ5t5Ĵ5t5ׄ6!5t5 h5t5 h5t5ׄ6!5t5 5t5 5t5ׄ6USOa5t5#*5t5#*5t7 ay!5t5% 5t5% 5t7 dca5t5) 5t5) 5t7 RS!5t5*T5t5*T5t7 aa5t5/q5t5/q5t7 y)!5t51xˀ5t51xˀ5t7W#\da5t555t555t7 G!5t57n5t57n5t7WjSa5t5;35t5;35t7 U8!5t6À5t6À5t7W$a5t6]J5t6]J5t7 ki!5t6'5t6'5t7W9fa5t6 S+5t6 S+5t7 E!5t6 5t6 5t7Wf]a5t6I 5t6I 5t7 !5t65t65t7Wa5t6>5t6>5t7 {tC!5t65t65t7Wp^^<a5t64΀5t64΀5t7  f!5t6(5t6(5t7W jTa5t6#*5t6#*5t7  DE!5t6$s5t6$s5t7W ba5t6) 5t6) 5t7  !5t6*T5t6*T5t7W 5a5t6/q5t6/q5t7  0w3!5t6055t6055t7W MJa5t65 R5t65 R5t7  _!5t665t665t7W ČIa5t6;35t6;35t7 ث,!5t71-5t71-5t7W'˪a5t7]J5t7]J5t7 Қ}!5t7'5t7'5t7WLǚa5t7"5t7"5t9C?s!5t7$[܀5t7$[܀5t9ܓ2a5t7(5t7(5t9C^!5t7*Q5t7*Q5t9ܓYa5t7.}5t7.}5t9Cq!5t70G5t70G5t9ܓDa5t73%5t73%5t9ܓ!5t76=5t76=5t9u*Fa5t795t795t9ܓG_6!5t85t85t9u*^_a5t8,5t8,5t9ܓP!!5t8w5t8w5t9u*ٶLa5t8 !5t8 !5t9ܓ.!!5t8 X5t8 X5t9u* fJa5t8߀5t8߀5t9ܓ(8!!5t85t85t9u*)a5t8 5t8 5t9ܓyNn!5t8ׄ5t8ׄ5t9u*6Ma5t85t85t9ܓ\w!5t8e5t8e5t9u*ƅa5t8!5t8!5t9ܓU!5t8#F5t8#F5t9u*%׶a5t8'c5t8'c5t9ܓ$!5t8)'5t8)'5t9u*Ea5t8-L5t8-L5t9ܓR!5t8/5t8/5t9u*Ha5t83B5t83B5t9ܓsA!5t855t855t9u*xa5t898p5t898p5t9ܓG@!5t95t95t9u*c3a5t9,5t9,5t9ܓyMSo!5t95t95t9u*nY5t9(5t9 /5t9 /j B5t9&%5t9&65t9&6 h p T.5t9-L5t9.}5t9.} x qߌI5t965t97n5t97n T| 5t:À5t;*T5t;*T G05t;25t;3%5t;3% R 5t;8ـ5t;98p5t;98p jf5t<bZ5t<5t< 0K5t<X;5t< !5t>р &B5t<I5t<I5t<I Am5t5t}5t=3%    ( 0x bm&m5t5t}5t=9 H P X)#m`5t5t}5t> ` h p x 0m 85t}5t}5t>1- $`d/^C"H *PMh n2>D`SOSݢ;}fjW7=: }+* \tuA蠏2a_Uu8`Eg) <v31l[])WyX@gN$WuU&|%fOawu"U)9Kő^ŕ-I#xC&|6 . .. catchmod cpn ddn df ednexpr lnn lsnmkdir mvn pwd rmn shnsttysync tartest[nwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: www:*:67: network:*:69: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: nobody:*:32767:  . ..|group} protocols~servicesdisktab.preinstall ... ... . .. disklabeltfsckfsck_ffsthaltifconfigtinitmknodmount mount_cd9660 mount_ffst mount_nfst mount_kernfsnewfspingrebootrouteumount . .. .hdprofile . .. bin dev etckern mntsbin tmp usrinstbin .commonutils<>.profile .instutils0install . .. bin mdec sbin share . ..chgrp ftpless|getoptgzip|more| sedtset| . ..bootbootxx installbootbinstall . ..chownchroot installboot . ..misc . ..termcap/bin/cat C  @D, @'8$x+#@  /(@j / "%8 %8 @<@s@ T`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!f"p`$   ǖ ? $     f bx      ?@ ?# @!  ?f؀! ?@ ?# @  f؀      fp?"  #\#`?@?# @!  09@ ! 4? ?c @ ̀@ 0'@@@ ̀@ ? ?c @! @ 0@@@! @ #d#h0   #d#h0  #d#h  Ŕ  ' f? "bp  (   f"p"pܘ@#\#`?@?# @؀! ?@ ?# @  Q?؀ K?@ ?# @! 2 9@ ! 3? ?c @ ̀@2 %@@@ ̀@? ?c @! @"  @@@! @# #?B ?@ ?# @!  6 @ ! /? ?c @ ̀@ # @@@ ̀@? ?c @! @   @@@! @    #d#h  Ŕ  c ?   (]  Z䀢 "fbpbp#\#`  #d#h  Ŕ  ?`?2 f  (9  6fbp$ 8#x$  $ ( 8$ bp ` ?f  @ ! ` ? f  h  f "bfb""@`㿘f"€ 㿘f" "? @㿘f"  € 㿘f"  ?Service unavailable㿐f"     ?1 !  @! *`:`J "J %s: %s not compiled in instbin-krb㿘@V@ J 2@@K@@bh /  @( @ @ "@W "    € d" b@ X@Ö@ 㿘 ?@?`Usage: %s ..., where is one of: %s㿘d" cx @㛔X ( @ @d'd+ ) @ N@  O4@㆒c☒#@@`@ d" @xc@ b gzipumounttset[testsyncsttysedroutermhaltrebootpwdping-shshkshtarpaxnewfsmvmount_kernfsmount_nfsmount_ffsmount_cd9660mountmknodmkdirlslnmorelessinstallbootinitifconfiggetoptftpfsckfsck_ffsexpreddisklabeldfddcpchgrpchownchmodcat㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@G-f  @fb` #%f +f#f)f'f @*h?:? 81d* /l///x/////////////////$%$b%b$%"$b$d"@@  $bd "@❒bp@  T#* @f" f"Ā f" f"  f" f" @d@d@ِ"@ "f  @`b@ X"stdin-r%s㿘d!f  "b3 / - +f 'd ! @Ȓ` @gఠ 2 @%b  $ @"@Ę 2%6d 㿘  'd"@ ? & @֐  &?` 7 'ff"  2 @`?"`@* "@ @f? Ԣf" f"   "   a@` @2  f"Ā $@`?"``@* "@ @/ $?@` ,ff"  ^@`?"``@* "@ @ ^? I@`?"``& I@* "@ " d , M@`?"``@* "@ @ M?i -@`?"``@* "@ @А -?T e   1 ^@`?"``@* "@ @ ^?8  ? @@`? "`` *:  " @* "@  @`? "`` , :  " @* "@ @?"  @ f  @bf "b ?6 d"L @  @_7b㿘dR!f  "b+ ) 'fd!  @a`  @Z 6  @P $ T`$ @T`"@ 2buffer8dR"Nf"  %f@ "ff  `@^؀d"$"!ff@" $"  @^ْc8%f+f) @b  @ @ 6 @^Ē"@ f  @bf "b㿘@$HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@ޮ  @ ͒`/!x!T@璔^ 0W* :<::::H::::T::`::::::x::::::::::::::h:x:p:::::::x:::x:x:x:x::x:x         #*?J@ -TJ`  TJ` $#@T#*`& @@  ` @/5`2 "@ ? @ @?А !%8$@  8 "$8#  `@]J   `@/   @Ӑ   `@.`@(i   @]ƒ  `'@)L G8 4? -* <==<=<,<==<=<,<, 2 @*p   @n @ǒ   @e @Ͳ  2. <@`* 2 @3 `@  #  @]r`@ usage: chmod [-R [-H | -L | -P]] mode file ... 㿘d"@ a@  㿘@,$Id: chown.c,v 1.10 1997/09/20 12:44:29 deraadt Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@J  @ ib0f( 8J  o`?"bȢ/#$+f )f@&8?E? )>* @@@@@@@@@?@@@?@@@?@?@@@@@@@@@@@@@@@@@@@?@@ Ȣ  Š    %b%" @T#*`& @@ f"̀    @-b@2 `f? ff?"b"f"Ȁ @@ : 2 *@@ . *@y @@`@s@`@'&   @\ !t)3f%f@( N8 4? 0* @AB B AB B AB B AB BBf"̀ @)* 0 @) "x@  @  "x@y͠  b @1Ԁ  f0 @2AԀ f"؀ "@i  #  @\&b@Ԑ%s: invalid group name㿐N !@$ f "bԐ@  b@\J f b@-'""ԁ%s: invalid user name㿐N !@M f "bА@̔  b@[֔J f c`@,""Ёusage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]group㿘( 8f"Ȁ " @ Pd"`@j@T 㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@ێ ""9!5 %d!-+@p ؀?O? *H* FGGGFGGGFGFGGGGGGGGGGGGGGGGGGGFGGFGGGGGGFGG  ƨ  ¦    &$@U$%%b@`T#&*  @@U"  "  @,`   " @,a " 2  @0o!"c#@/ * 2 $#@/`?. @@K##) ah@+`H@L!)@=`H`H $ @ .,`H$ @*) @`  @ )) I@J /"@*@ @) @ @$ . &@ @ɒ 8#  a@Z <  2  @@' ) " 2 @"  @@њ8@@@ѭ8@<  2  "  " " @@@%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8@$Ԧ   @Z +) @)) H) I/<-@% 84   0 !@" "(@ K HV2 2"$@Z  /  " @bH "$"@L / L? / /, $#,"PH @%`@,`@) I`@J /%`@*`@ `@ H@о?2<- @2<@2<"x H@<  z @&8 0t      " H@ 0d <  @ @Z@M0`@I(@[@^`?Y "  "  "@^@% 6 <  H@ia 6 a@Y H  8 "# a@Y H"  <@ 2   H<@/`0 " <@q`? " <@A`? @3  #  @Xےb4   @4     `??%soverwrite %s? 8 @ ` HE<" ;d"`P)@_Hd!`? "`@ da  "a  y#da耢 y`? &`@a  $a耢  y Y)@z ) H$ ) H& @Ϛ?   H)@`H@ѐa f")+)@@ @q@ H H@r`H `  H@j  @@8 " @˒ 2# , #@@ڒ @ o#@-*@  H)@7`H @z@x  H)`H@* readlink: %sunlink: %ssymlink: %s㻘 @$# ` * 3)@"`H # `H)@,`H #@~ 0 "  @ <mkfifo: %s㿘` 3)@`H  #3)`H@-   x@~Ғ`H  "  @8 mknod: %s㿘` 3)@Ӑ`H  #3)`H @,  !@~`H  "  @ utimes: %schown: %schflags: %s㿘   -6 b "b @h#$   $  $@a#$`#)`H@+!@~s`H `  @-   8`) H @-0  8# !)@~W`H   36 ` @,   8) H@-  !)@~>`H 8` "#@, D  80) H@-  D 8# - D !)@~`H lchown: %s㿘!) H @,i   8# #@~  H  %s %s usage: cp [-R [-H | -L | -P]] [-fip] src target cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directory㿘d"`@fH@P 㿘@Y_4Y_XYb,Y_tY_@@Y_Y_Y_Y`( Y`4@@Y`Pskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈""`"8  G"c '%@c $c @'ac@ = 2, @'c L c b@&c'`  @ߎ#  @& @" b0@& $@  "c`@"@ " ` @@|"`  @` @&b#  @&b  #","@`#`!` @"""`` "`#"` @&b#   @&yb""`#8   2 @&gb#(  ?#@տc  4  $    ?#@իc  4   $   c0?@&7㿘@B@㿘@"`"8㿘@"c 㿘@ "c`@ 㿘@*"a܁㿘 @ې"c8 @㿘 @̐"` 㿘@!:㿘@:Ha paa qa raaaa ma na oaaxapaha`unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 .'D#!1D@Wa' l  @"   a@%W@  b@%N &  `D" D ڐD㿘@L@%s%s: illegal numeric value%s: %s㿐@ ? c@S c@%J k m b J w J . . . .  'J x   *2  @o!@} " c8@$# c@$㿐@  #   c@S c@$J k6` m b 0J w*J6`.  .` .  .` 6` .  .`6`.  .` 4)!@$! 'J x # % *2   @ְ 4!@!@ " c8@$O# c@$J㿘 #(  " *@`2 @ #(`$ `$  @ @  $` $`0 㿘# &?#(`  #(  2 #("`#("`#(@H"@ "#c("` ?"`#(  "@ { )#(-#h # @8 ` `   +   ` `  +  ` # *" ` $?$#  `" ` #  @" % "` "` %` "   ? $ 2 "c?$#  $@ $@*@֐  #(#( "㿘#(`"ch` "`! ` @"@  `@ `" ` !# #0 @" ``#  "`㿘 ` #(   @ @,@??#(#(`# @ 9  #( @?@ "@ @ @@: @@ "@ @V$$ $ *@`$@ # @W # @ " $ ϔ( " (@/"@ #(#( "%s: short input record㿘#c(  0 @x c( @@ #( @ @ : @#(@ $@ `!  @ @$  @$  " * "    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@ @73*  @a  @a@#a@qaܐ??&a@@} stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘#(`  "`"`#(  @ݔ $  `@O !@#(*!܀  #(   @ `  `  "` P."`  @"&@Ʈ!` "`  @"&@ƞ!`"`` "`  ! `@OO!@   @ !#( ` @1? $#( @O6`Xc(" # c8*#c @  "c(!  c @@ $  @O`h#(#("`  "` `$ @   $@@   2!   @n    @\  "@K`!&b #` *  +@ ( 3#_ *  +@ ( " " #`*@ `+ (#_*@ `+ (#"`@3# @Y` h `@N <     a@ޔ     @w ?  8#   & 㿘'#h#)#(/  #`h ~`@  @    @   @  g$ 6( `$ @N/ @ug @V  `     @" @@uU ` $  @ $  `$  $ h $h"$  $  @$  $  $` ` %@ $ @@"  "  $ @   $  }㿘 "Ѐ@ #@  "@  ``  " `       " @.  "  @ %s: end of device%s: short write on character device%s: short write on tape device㿘  `  #h+`@ 48 a@`#   `@MI`> @ B  <`2*  $  $ `  c 2 ` %c!0@tT`` "Ġ$ aX@K``"$``   $  " @"@    "%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @p#"@`' 'h` #\ d@h`@B`@? @`  ##  dh@*@& @ϒ#h ``##  d@@  @!#h: @  #\#` d  @@ @㿘!8#$#㿘@ %sskip reached end of input㿘#(    @     @E ?FD  a@L: #(  @: /#(+*- (@s   %@D? @ a܀ ?%a  @>a $ @@sA0 @ @K@2㿐     @m     @ ?  a@K     7 $'  a@2 o  a@K     `4a $ ]``@ H   a@K7 '  a@?  a@K `D  @ 41 $ -``@   a@K `D  @ 4 $ 0`D   @4 $㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@E%!#  #-+)'!@,؀?L? $E*  $$`%$`$%`% $*# 8! @a@#!@!T#&* @   !@q"@@F  2@ !@Jb0 @[@. ' @"T #!@@Β  @m@ , >b`< @@2 @, @@U 20`- , @g $b` 耢 ",  @, !"h@q@`@T < 2   !"@@q<`@q@`@  @.  @Ő 4 . ` $  @0@$@ڐ 㿐@  6 , @ @X  @ L,  㿘*#  *  ؀`?#@W     ؀@ empty type list㿘  N  n "@ c N  o  "`" آ  @ , ``!*`@* $# 2$ @I   @̒ , ,`*@`$`$㿘 耢 2*# 2 쀢 @, /- (+)'`耢 ,` ,`w < 쀢 ,@ ! ,`, L@_ `@`* *5  9 *) *( 9 *0*8 9 *@*H 9 * P*X * ` B: 0B %5.0f%cBKMGTPE %5.1f%c㿐?*h B#@"0*p?##Ⱀ"  ##"@J㿐   B?'  B?   B?%-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐##ؒ @   "@ @ C ` @6  @Đ@  @缒@Y  ` @6  @籐@箐  @穒@E ` @6  @睐@  @畒@2 ##@E *'' cx Bcx#?@1# $  ` "@'' *cx B*cx$  ?@$@ $ @  L Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐  $"p@'$"x  $'$"@v'@$"$@ "$$@"$@#  ,  , 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*ld %10ld %11ld %5d%% %s 㿈 $% "% @% 0$@j @c% h-` "@,* * @枒@~@@` @6 @挐@ @愒@! ` @6 @y@v #\@q@ #\` @6 @e@b#`@]@#`#dL#h@ `@-`㿘@g !"`@n\?@\ @  @  ?  df: %qd: %s 㿘@ @@@8# `4 @d"%@Ȩc  usage: df [-iklnP] [-t type] [file | file_system ...] 㿘d"%@Ȏc@x ffs㿘  "DF!T@"6;?6!  4& 0& (&  @` 8 ̢@& d <" @W (@嶒 d ("@" & ,@N ?& && &$d L& L@ Z@ Z<&`(@ .K lfs㿘 g  !b@"6N?6!  & &  "@ 2 &   "@ $2 & d T" @ @乒 d& $@ ! &   "@: `&&``(&`$@`d&& &$ L&!hL@ Z@ Z<&ap@E .K ext2fs㿘 $$   8;#S@L?L "6F?6-$ *@& *@& (@[4`  $? @S ?4`@M@㏒@$&  & " && && &$ L&"L@7 Z@3 Z<&c@ .K 㿘@`vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBENRWb:enrs:tvw%srioctl DIOCWLABEL㿐@l '"t!+  +)'#'@R؀?? 8* llllllXllllllll|llllllllllllllllllllllllllllLlllll\(!  @ $!! "'@'$!!  @ $!! "'@'$!! "$!@~$!a %a! %!!  @n ~$!ᰐ z$a v$a@as'T#&* @+a   "a@O@"a+a` ` ` !@! + 'a@D!!?`(!8*` P< @%@  @ @| @@ @ @Sl @@ @ ! d"@@0"@@A@ Q? @ !a@p`'@a ' a@D'`@ P 4.a! , `m@v % '@Da?  @   ``!@!3a!@:!@돔!@ ; a@x@자unknown disk type: %s㿘@  (c@ @o! @m `@ DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %d (0x%x) lseekwriteioctl DIOCWDINFO㿐  !  )@j !) H@j!) @j!)@j ~ !W&&6@ T6! b!  e`f@ꭔ  8#  )[ !  `&a`:` )!@: ! 2&'@) 6 )!(' `m@{ 6'@}!@A )!0@} 0$'! 2  `m@^  '@}! ! 2  e`g@M  )!8@H %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘8#   '0 '0)@i#0)@i#0 *@i H0*@i p0@i!reading label from block %d (0x%x) disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCGDINFO㿘! l  !    &*!P@: @=  a@|c  'a@B)!! !W@* *  @ *  Da@i>!a "a*!!  !W#* @2  2   ax@ *  ax (@i  !e`e@>   *@Aؒa*a!@i& Bootstrap doesn't leave room for disk label㿘`( "&`(&` @ @P!!Ԁ*!J  @ؒc *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:㿘+ N` +` @`N` +` @ `+ @|`  *++` +``@+`@`(+a@`,+a@`0+a@`8+a@`4`H+a @ה'!`J+a0@͔'!`L+a@@Ô'!`N+aP@¹'!`P+a`@¯'!`T+ap@¥ !+,@ \@›!, `K`+  @a+@‡`+, < a@+a@y +*a@ +- a: @e  2#+- <  @Qa@T+a@N` @@ݖ_*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %20.20s # (Cyl. %4d- %dp. @ ._`:  * : ` ,"X*` Dl' ?+B?`(' +BD? ' ?+B?`(' +B荡D?' ?+B?`8' +B? ' ?+B?u`8' ?+B?$@@`(' +B? ' ?+B?M$' ?+B?@`(' +B? ' ?+B?'' ?+B?@`(' +B? ' ?+B?@`(' +B荡?+? +? #\,apa@ .: #\#`#d#h#l,aa@  +З*,a ,a @  , @ ,a '@Ә!`8 @ ,a @ `8a'@`8`"_ @l ,@a @H`8   ?`&  @& *  *?`&  @&  * &@x  `8 @??,a@@`8  ?`&  @ * ** &@xܒ ?`&  @ ) )* &@x˒ ? &  * & @x# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐.a@`  +*.a .a `@.a0 @`.a@ @`.@aP`X .@aX`X .@ah`X .@ap ? &  * & @w.a@x`(.a@s`,.a@n`0.a@i`8.a@d`4.a@_`<.b@Z`H.b@U`J.b0@P`L.b@@K`N.bX@F`P.b@A`T.@=b , @ \  ?,  &  @%.,`@ @%\`@,`.b@`ْ #\.# #`.b.#@    `@Ow # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) re-edit the label? [y]: +@Y!p"'/@ޒb` '@$'!+@cْapv '!@cӒm+@+@!pi /@Nbh/@Jbx@+!p`d"@d!@l L'@Xa ֐ @!@  @!a @0@. @@l`? $`@ː  $  n n`? $`@  $耢`  n N+@|!p sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀0"'0"'''0@ᬐ" 0"@䀐+@|!p@  0@c*"J 0b+@vpp' @ @  @ 18@> # # 0@e 00"@:@! @c"@ '@ߐ@)  ` @:`  @⻒  @⸒  @ⵒ 䀠`? 㿘1@&`L  㿘11@X L "  , @ L  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐 &`&`5171-1+ Р#@e V`1@'aH 2,@ @ʒ : 2 ,11!P $: 6`1@ah 121' !@ap +' +  4+  " @ + *@ '1!x@a6`1@a 4.'!1L@ *͐@  '@Ḁ  '@! 1 '!Ȓ@am 2L@p&`X1@ta  @"fL@"b 4_@, @ "`\  "TL@ 1a@> ?  1"@a7 6`= :6`'!А1@9b  `1@1b( `@ "1@%b0  @K '!@&`(1@bX  @: '&`,1@bh  @, '&`81@b  @ r'&`01@b  @ d'&`41@ܒb  @ V'&`<1@Βb  @ H'6`H1@b  @ :'6`J1@bȀ  @ؐ ,'6`L1@b؀  @ʐ '6`N1@b耢  @ '&`P1@b 2 @@  '@@`jr o&`T 1L` 1*`: `@ `1#`6`*` @@  '1#H@`< $1#0@`1 l@f  '1#h@`" $3, V+ А L+! " @ $ *L@e @ `  @4' : ' 1#@_' ,  @ $$@ '@, @ $ @'@, 1#0@_ @4#@_ @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘  (2 ,4 ! 2 04! 2 44!@^֒   2 H4!@^͒  H 2 84!@^Ē  8 2 < ,@K 0& 8 < 2  8@C 4& < 2 4"@^  @ ( 4@^"0 4"`@^  @ ( 4@^"x `4"@^ I ,`     4*`"@^z:`@Ţ 8 4,#@^p:` @Ř 8 4,#H@^f:`  <@4,#@^]:`   < 4,#@^Q:` 2 `  4,#@^D:`` @&`a`4%5,`    `a@^+ ``,` usage: disklabel [-nv] [-r] [-t] disk%s (read) disklabel [-nv] [-r] -e disk%s (edit) disklabel [-nv] [-r] -E disk%s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] -[NW] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x%'5ؐc`@ߔ @ʐ,@!d"5@c"5c@"5c@"5c@"6`8@"6`p@"6`@"6`@ c"6a6@ܔX"6@ؒah"6a6@Ҕ@޼  (    *`2 vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsYou need to specify a disk type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.fictitious Initial label editor (enter '?' for help at any prompt)> Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. m [part] - modify existing partition. r - recalculate free space. u - undo last change. s [path] - save label to file. (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 w - write label to disk. q - quit and save changes. x - exit without saving changes. ? - this message.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder./usr/bin/lesswIn no change mode, not writing label.No changes.Save changes?Save changes you have made to the label?nRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.unable to write labelUnknown option: %c ('?' for help) Ƞ0@ۛ!7@`@@,,@    7@` 䀢 277@,  8$  7$ l$, 4 , $ 7@! H7@a 7 ' 27'7@!А`0@S!/d"@7"Ȥ`0587"@n@Đ@<0$@ G 0 ? "@* %@ @mÒ  q/0/10@ ڒ 7 @ Ԓ @?* : `nӓ*`9!H hxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxD|xxxxxxxx``xx7@O" 7@L"87@I"X7@F"7@C"7@@"7@=#7@:#@7@7#`7@4#7@1#7@.#8@+ 8@( (8@% P8@" 8@ '7@j!@f!,@@\!@X!@E,@O!@K!,@ @A!@=!,@-@3!@/!,@ِ  L@ɒ,78!8@a "7!+@## @ @Z7! 8 !0@ܔ! '88!@ %8#`@ 0  bL*  R  y n2 `L"*`@R` y2 0@֔!a”   0@V,8@u"8}7 8bX8h@ M L l78@}a 28"@YL_7 0@4Y70`@w! 28@E"M7@ّ!@ٍ!@ى!@,8@2":7! 8@)!170@O! 8@!%7aY0 "8@X"70@Z!@V!@ Ԓ,@*! 27@H!78"@}L@7No space left, you need to shrink a partition Partition must be between 'a' and '%c'. Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. offsetStarting sector for this partition.Command aborted Invalid entry The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. sizeSize of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Please re-enter an offset and size for partition %c. FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.㻐@ ; d@jߒb0 Nd";`@ p0, ` "H ` Cd";`@N0Ց, 2, a//+;);!d%;#;a(!8@ N, `  ` "@~`""`@v p 6 ,  6  @8  , f$, $$ ,  4@$@*$;!;!!d    #\@;!@jB"!@ ;" a!@ ;"b@$ , @  , ", ,      "  ,  2   2, ;# ;#(!d @   #\@X2@;!@i"@ ;"@ђc@@! ;"@Œch`$@ < @zȒa$h$ /+\+ <`P<X@   ;!d+"\, @y@ ",   (,  &< @z  , ;d!@ib$+<)<5;!d #\`Ȗ @A 뀤@i" ,  2y@+<)<5;!d#\a(!8@$ ΀@ic"`$<@ʐ!p :5d!<#< @7#\!a@ ;!@e@ @`!<@$!@ < "(@  <"h@i$ !<@̼, 2@5<+<);!d#\b@Ř o!@i"4@" &@@!@@є? @partition to modifyThe letter of the partition to modify, a - p.Partition '%c' is not in use. Warning, need %u sectors but there are only %u free. Setting size to %u. The OpenBSD portion of the disk starts at sector %u, you tried to start at %u. You can use the 'b' command to change the size of the OpenBSD portion. 'c' partition may not be larger than the disk Size may not be larger than %u sectors Please re-enter an offset and sizeError: block size must be a multiple of the fragment size.Error: block size must be at least as big as fragment size.㿀 >b>@ 2N;!d@hEb0,   ' ' ' '   d";`@`0 d ` 2 ` @ 2 ` d">c0@a0| (+\+ <`P<X@_  ;!d+"\, @xQ ",`   (,  < @x ,` +<)<5;'d ` #\`Ȗ @ ??@gے ` ,` `     @ `    ;@@  d">cP@ `,` &@@@" &@;!;!'d` `    #\@R?l?;!@g` , !@ >☒c@p`$`'d;;@@ #\ @,(@-?C?; !2 ` ` < ? 8@g\; `  "$@@@@ ?@9`h;@"@ &@$@ $@@ ?@ $`$@;d!@g-b$@;d!@g&b$@$`$`$` `  2m@+<)<5;'d`#\a(!8@Ě$?ހ?@g` $`<@j!p` "2 ` 'c0@ a00*A pd@fb0( a! *d"A`@0 `   *`` @ &@*  @Ӱ device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] 㿐A"@va+$ *`A"@v A# @v A# @v A#(@v~ (A#@@vz ,A#X@vv 0A#p@vr 8A#@vn 4A#@vj <A#@vf@A#@vb HA#@v^ .>;!#\A#; @vM  @#d,b@>` @b@㿐@ k ! ? !*@" @   *@*  * @* @ ߑ*  @*  @( *`#@ِ    "&@*`"@@  * *   *&@@partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Only %u sectors free, you asked for %u 㿐 BcB@Ŗ 2J;v!,    d";`@L`0| d.  .d">c0@=a0mB#ؒa @uG@ @@   #\CC(@ ??;9!2.;4!Ȑ E !  # @ d"C@`x03. # @" &@. " @ &@.  < ? 8d@cb0."  a @Ɣ? @㿐@d   !!* : * ?`@ " *@ @ %s: [%s] 㿘*!C#'d"@d!!!7 @t@ؐ@1,!$@\ ,!`  ? "@* $@ @bԒ $ @% $L!?N ". L! ?@ِ L! L!  ?@|#.#L! ?1!%s: [%u] Rounding to nearest cylinder: %u 㻐\  /+d"@d!D!8@t7@u@0ɐ$@ /  ? "b@* %b@ @bq а?@ ?L@ O ,@O ?O@uO ?"D *OO O} z x`.J;`b*   ?* : ` "D# *` D<xxx`xxxPxX 8( $@h(*;O`+`-2'  '!8$#@~# "6?J 8 "c.?+' B + '  +@' …B' +-"'`4?2 '+B8' +B+D+ +D' …B' @ @78D!H@sI Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@  0@^ @xd"@+Ed!` 6k`,` @,  @Z,`?l"2 , ?l"2 E!x`a@r aE@Y!   溘 Đaؒ`a@rؔ a/$@ O X? "X* $X @a ) O`  ?`2ېaؑ* * @ @&@@ ,``@ &`@ Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.`@|!F 8@qa+"$%d+F)FFF *``p KF@p`Ȁ   , @p    (,  (F @qF @`@ , a@q !@`@  ,  @? "@* $@ @_ƒ F6 FaF(   ;!d;d!@`Xb0@ &@F@";d!@`Jb`@!0@y . ')F'F%;#d ,#\ !p ?䀤?@`-b ,& ,)F'F%;#d 0#\ !ט ?̀?@`b 0& 0)F'F%;#d 8#\ !ؖ ??@_b 8& 8)F'F%;#d 4#\ "@X ??@_b 4& 4F"F"%d# <  4@¿ 4@»#\ ?|?2 <;!@_Ò < a f$ <a"@ F@c < <"@@" &@a8"a& <)F'F%;#d H#\ #HPM ?C?@_b H6 Hout of memoryfailed to sort partition table㿘   * `  "` 2  *,  6@5 @x2    H@`x  `  " `  *`2`$@  *, 2 `  C@㬀 "6@ H@$U`6@Possible values are:"IDE", Disk type㿘 ?* 2  @H@}!H@p " 'F+"$#F!d.`@p ` a@^"@`` .`d@? "@ * "@b@* i$b@"@* d%"@ @^6 #d+"$HF6bp%㐠 "HF@o`Ȁ    6  b@? " .`@o  2`6  "@? " @^ 0-` (.`F @oF @^b@ %F!F.`@o ` !@^b@`` .` b@? "b@* $b@ @]ْ HStarting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)I'I!#;%d! <#\  ఒ2 <a@^=0*@! -I+I)#%;'d!a <#\ a##@2 <@^ 0 "@! "!"!@`㿐   !"!!& & F& @  @   !"!@ "`  +! **@  @  @+  `" @ @ <+  @ <"`  &ܐ1!+ @" & @   < ᐄ "@   +   "  a a* @ "@  + 㿘@ cannot seek temp fileout of memorycannot read temp file㿘!  "c|## @2 @ :#@* 6  @]& ;J!{`  :" b :#`"#: b"" @Ǜ ::@] ;J * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? "c;  ;@"[ ;  = @" 9 "":"":c? "c;  ;@"B ;  :@" :" @+  @\ ;J!`@ɏ   > #@ B ;#:b*bline too longcannot write temp file㿘@А   @\ ;J  N 2 &#@#;J# #* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * D #| &# @*   !@\D ;J!`  @#: <#"#| @ "$??:@\% ;J!c @ 0 !#<@ <`#@ B <# 㿘!@3#&"`"& c "c# $#invalid address㿘!@    @@@    !@;K!b@Ɣ ?㿘:#`"#:" +#@: 4:@H:::"b "b<:!"b:#2"b: "b?"b(::":`@:: "b?"b::a"":  "":"b "b:c? "c;  ;@  ;  :@!5 :"/tmp/ed.XXXXXXw+cannot open temp file㿘"#h"c`:bL`H`H;b "  2 @D* ? L@ʒ`X "c?:@:@[9";L!``@ ? cannot close temp file㿘# @  :@[";L!a8@  ?"#:@""#|  :c 㿘# @w:@"@㿘d!cT@s   !"!"`  P* ``$*   P:* *   ?P ( ? 㿘::"#$"c ! @ȡ @i @2 #@ 2 ,@  㿘:!:$# @"$!@5$# :#  !:$ `"$?㿘!:#$  !@ :"c $#$:#  !:$*@ `"$?㿘!:#$  :! @:"c $#$:#  :!c$@  ?Enter key: 㿐M@Ȑ N  @ @$ @: @  㿘 2;8@jL#;@X!?Ѐ6M(6d6l6t6666667777777777(7<7P7d7x7777777777777777777777777777(7<7P7d7xK I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?bad hex digit in keybad binary digit in key㾘N@ 0N` x X28N@` @%M *`: P , ?$@ = N@ @ 4  ,   "@ ,   `*`,    @.  , A 0AN` b B;` @%M *`:  , ?$@  N@ @ ?4  ,   ?"@  , *  *` ` .    "c@r des_setkey㿘#  :#   @ 2``$ @   ?.  @ї N!des_cipher㿘`- !  .``$  ?@A N"* *` *` *` *` *` *` !*` c@ň".  !  .``$  ?@ NY"  @decryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @' I / / / / / / / / @˖? N" !  . $ **`*`*`*`*`*`*`@2 N  N#@%{ O  ?O @ݰ?invalid pattern delimiter㿘# J   ;O!a@ٔ =?@ J, : @"@!###4% +) c` `    @ `?2@ ʤ#@  p unexpected end-of-file& no previous commandout of memory㿐  #O@}$c(@ ?;O!c8 ;O!cX @d?0O#0@&)'%:#d@k "˰ v %# @{ d!@M  'x@J?  ?4  &?Ā  Ox@|֒c(  xO@|̒cP `dr@ `:#h@`:#`"# "&"@@ ::@W ;O#p #p* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? g"c;  ;@i ;  A?@ =?"#h$d:c? "c;  ;@Q ;  "@ d@íd"#L@ M!@  & @  &  ##@Ɛ # J 03㿘#\ cx [#:c $cb#X@ ,  9@V ;O#p #p* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * c? $c;  ;@ ;  &?@  "?"#x"#X:c? "c;  ;@Ȑ ;  @ \#X*`"`"\ 㿘)\3X 6c.@ c'@  !4 !\c \X* 2c\XĄ  ą(\@ X*``"ā㿘#:c $c"#"c"\"x!@;#X$#Xc? $c;  ;@? ;  @~ rcannot open input filecannot close input file%lu 㿘N ! Q@Xc@|Q@f̒c  @U;Q!c  @= 6N*? ! @ز  ; @~  ;@Uq;Q!c8 @S?0  QQ#P#Xd"@t#&newline inserted newline appended 㿘p hc`#@`?"h"c`:#w"#3:%;@ Nc &c#܀  c? C&c  @  z?@ِ v?$ # @"` c? %&c  @{  \?@ X?c? &c  @h  "@  A? `R #h   #`  ` #`R d@Tb#` #h  "   "ch chch"c`@"c`:#   "@out of memorycannot read input file㿘 3+:/5;!R#-;:# " ِ? % @}C  %`  @d` b cp T c %c bܒ" @ 24&cp@TP R #. , , , , , , , , , , , , , c? %c  @  ?@ ?%c? %c  @  @Ր *,`   "c` #p b :#`"# b#ܒ" @ :@S ;R# #* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? <"c;  ;@? ;  I?@~ E?"#p"#:c? "c;  ;@& ;  ` @e ` 2 #*  @ @S ;R!c@t ? #ܐ *@  "ch#*#` #h  2?wcannot open output filecannot close output file㿘N ! T@`0@8@d` @SL;T!`8  @4 6N-? ! @n  ; @|  ;@S-;T!`P @?0  QQ#P#Xd"@0&  㿘5 :#`G`&:-+) @: @ `c` #h *@ @ ?`@:# m  "@cannot write file㿘"# !:#;%T#  N@`6  `@t  @R a@ ?# unexpected end-of-file㿘#J@ `#Ȥ"@@a ?'k#':# b :#`"#:#" @ ::@Rl ;R# #* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? R"c;  ;@ ;    @  "#:"#:c? "c;  ;@ ;  !:@ !:#c@# *?35;1:-:+:!R#/;@ & ax@J?  Tc`@ߔ ڰ # T  % bc" @t 24&#@Q R #. -  -  -  -  -  -  -  -  - - - - - ? %  @9   @y  %c? %  @%  c@e cax@`c@g  c *?:# b :#`"#: b#" @ ::@Qn ;R# #* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? T"c;  ;@ ;  " @  "#:"#:c? "c;  ;@ ;  :@ :c*'cstdincannot read stdin㿘 9d!7-:+;;!R#3;5 ? % @yʐ!  '!耤j 㤀 U   % bax" @q 24&@Pݐ R #/a , , , , , , , , , , , , , ? B%`  @6 ` H?@v D?%ax? %`  @" ` ax@b ax*,`   "c`` 2 c "c @V@P!Vaa@h  ?5 &? ?5 r axax*ax&ȁ%ld \  \abfnrtv\㿘 W@a H W5d XW h ; !PW P@Pk@ "{N ^*`:  \@`?w"``x 2r@0t \@`?"``@* "@@O \N`  @ix "L2  0@`?"`` @* "@@Ou  82  0@`?"`` @* "@@O^   0@`?"`` @* "@@OH  @`?"`` @* "@@O3 c d@? "@ * "@ @O  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'D@'H;  @"@`$ $@@J? r`?$)X'%8#; DH@ ? s"$` x pd;d ;$d:"c"aH@2@ T* H 'HD# 'DHJ -; " D H" 'HD?'D@U ; "` @    <     @8 @; " d@j"@@ @4 "  m@/aT l@+cL @(  l@$c@͂!P X d@Nb;X  * `* `* `* `* `* `* `* `* ` D* ; "` D  HJ@ D@ H H;  $J@ !!;@L_ #:D X d@NbHJ  ;;X!`(@P ;  #:^ #:!d3;d"@5/X"-;+X%X)d!耦  c X"`@@]a#d @Nh@+ ?*̀ ";   @NUXa`H@  2 c ``x#@1a  ?4 &ð? !x@J?  Xa`@  ?4 ?@a"#P ?@0 & ? #@ ?" &?? 00/ ې &̐ @N"Xa`H@   c '``%x  c ``x"#@Ֆa0 "xX @"@̔a  @Mْ" ^ c ``x"#@a Q 㿘"!#"c"#  1%@< a $a#$$##J , ; #J `;&#$!! 4  "@# c"# ?number out of rangeinvalid address㿘##Je @ `   J@  `"J`  #ȢZ!h)e#%;'Z+#cJ? U* jm0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0jm0m0m0l4lm0lm0m0m0jljl4l\kkkkkkkkkkm0lm0m0m0l\m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0jcȐ`$cJ` @ ` cJ@  `$cJ`  ccJ    c@aŔ  @@ -8# " -Z`xy  ^2y w&    d - ^2_ j?`cȒc@a  P 8# "K Z`xO IcȐ  .8$cI#@@ / @ /`? ;cJ@, `)$cȀ,cȐ`$cJ``@$cȰ  *?cȐ $ca "a ;#"c &@ccȀ ?c  @? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘 #Je @ ` J@  `"J`  cJ p="c[#p* DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDHDDDDDDDsDwxDDDDDDDDDDDwDDDDDDDDDq4DqrsuwxDyz{|P} ~D@XwD̔ cJ n"   p l" 2 cȐ "cȀc#J@` "##P @@ # #@  cJ n"   p l" 2 cȐ "cȀc#J@` "##P @h#@c @ # {y?#@w q cJ n"   p l" 2 cȐ "cȀc#J@` M"##P @.#@Xc E# #@  ;9"##̀ ;  "0?! ;[!a# #Je`  ;[!a @  cJ n"   p l" 2 cȐ "cȀc#J@` "# @c &?@ &? 6L?  !; @H L  ;J  2L;[!aǔ  ; r &?@"#;;?"cL"H! ;[!a #Je`  ;[!a @ "?L ! ;[!a cJ n"   p l" 2 cȐ "cȀc#J@` i"#L ; @G;@ @N0c#P ;[!bW  @Xc R`g `G  G`G `V  cJ n"   p l" 2 cȐ "cȀc#J@` "#cP "cPӒ ! ;[!a   cJ n"   p l" 2 cȐ "cȀc#J@` "#2;! ;[!a  cJ n"   p l" 2 cȐ "cȀc#J@` "#: #"@ `"#;!J! d"X@`@0#  ;Z!` cJ n"   p l" 2 cȐ "cȀc#J@` "##P @f#@ ?e # @}` w cJ n"   p l" 2 cȐ "cȀc#J@` S"##P @4#c M@ . cJ "c#  ;Z!`6 cJ n"   p l" 2 cȐ "cȀc#J@` "##@  #@  cJ n"   p l" 2 cȐ "cȀc#J@` "##c@ U   ?#@ ## ! ;[!b(̔ #`# ;Z!` c"#@ "c  ;[!b@  cJ n"   p l" 2 cȐ "cȀc#J@` "##P @m@ n #@  cJ n"   p l" 2 cȐ "cȀc#J@` ]"##c@ Ȕ  \ Z?#@X R cJ n"   p l" 2 cȐ "cȀc#J@` ."##c@   - +?! ;[!a  cJ n"   p l" 2 cȐ "cȀc#J@` "##d#d   8# 2"@;!"@! ;[!a  cJ n" c p lc2cȐ "cȀc#J@` "##̀ Ȱ?;  À`q0#Je`  ;[!a ! c"#@#  cJ n"   p l" 2 cȐ "cȀc#J@` "##P ;@b; J  L ! @DL 2 L;J  2L;[!ae  ; c &]?[#W T"c##%;cJ g"  p ". ) 9( 0$cc r 0  cȐ $c@[ ;"!0 @@2 8# " , ?$, ; cJ cȀ  ;!(  ;[!bX  ;"!0#J@  ;J` ;;[!bx !(:c  "c %;@ f %;:c? "c;  ;@  ;  Ѱ?@  Ͱ?(@ ";@E@(;"!(; "a :c? "c;  ;@  ;   @    ;!,;@ a0 #P ;a, a, ? "a,;a, "a, ;a,  ?"a,;cJ n", p l ,2 ,   ",cȐ "cȀc#@i c cJ n"   p l" 2 cȐ "cȀc#J@` ?"##P ;@ ;;;!(a,@0 #@5 /## (! ;[!b( #`# ;Z!` c"#"c cJ n"   p l" 2 cȐ "cȀc#J@` "##P @@ɀ ! ;[!aה  cJ n"   p l" 2 cȐ "cȀc#J@` "#@ #JqQ?cȐ "c#Je`  ;[!a @ !  #  "#"c @c &? cJ n"   p l" 2 cȐ "cȀc#J@` ]"#; J  L ! @BL 2 L;J  2L;[!aH  ; `W[["" , 5#0"##̀ ,;  (q&$?! ;[!a  cJ n"   p l" 2 cȐ "cȀc#J@` "#:"c "c# @@ ## ?ϐ  @YO ;"!$ @#@ 8# "  ;Z!`x@ ;"!$ cJ n"   p l" 2 cȐ "cȀc#J@` "#c;c!$@@4@  ? cJ n"   p l" 2 cȐ "cȀc#J@` r"#! ##[@T"0l! ;[!a` @ ] cJ n"   p l" 2 cȐ "cȀc#J@` 9"#Ȁ #X @@T`#@u ;  0[@T"0, "c# @'@ !#@ ?;[!b ;Z!`x@G ; "!0;[!a @=?㿘! "#"##c 4 ; #@  ;Z!`@ ?no match㿘D#%+)`  ?, #<ˢ +c` ` 1   @6 #ڀ`;d!( !(* `* `* `* `* `* `* `* `*?filename too longout of memory㿐#J` Me @  J@  `"J`  #J  ;X!`(@    "cJ@ !`@"Ȁ ' #X @@S`#?  ;d!b`@r  ;!8`4]'!:# $#;b!4@ 9;@Bt ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * #? H$#;  ;@ɐ ;  = @ 9 "!8;"!4:c? "c;  ;@ ;  "'@ '#J ;a4# @* `##Ȕ' J 1;!4*@@ !4 !4 shell access restrictedno previous command㿐 '; ;e!a O  "c°? ;a@ c :c "c;!< "&"@@] :;@Aɐ ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? "c;  ;@ ;  u?@\ q?"!@;"!<:c? "c;  ;@ ;  ;@C ;!< !*@#J Ϥ3;):/;5;!7d"x+; !<cJ !k %Ea@ S # %# b<" @ݒ 23&a@@AI x. ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #? D%#`  @ ` ?@ ?%<#? %#`  @ ` <@ϐ < *@J \U%< *%NȀ_a@ S# %# " "@r 23&a@@@ސ x. ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #? %#`  @8 ` ?@x ?%<#? %#`  @$ ` <@d < @*`%# eJ  e9a#ta@ S# %# " "@ 23&a@@@r x. ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #? m%#`  @̐ ` %?@  !?%<#? %#`  @ ` @ #`#t@ :|< *@t  p;J  ;@ @'a@ [# %#" "@ 23&a@@? x. ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #? %#`  @T ` ?@ ?%<#? %#`  @@ `  @ < *@??'Ȑ%cJ CcȔ# j :#`"# b#" @ B@? ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? "c;  ;@ߐ ;  7?@ 3?;[!aؔ @7?0*"#"#:c? "c;  ;@ ;  !@ !;#a<@"#t#*L ! % 㿘 "#-d!)!:';+#P # ?x@J? x ?5 `u s?N #J `  %#J ` "#Ȓ"`  N . #N  #T # $#M #? $#  @K  =?@ 9?cc$ @  #? $#  @,  ?@l ? "c#? $#  @  {@T w 㿘 `#@ ⠐@t 5-:3;9;!d"x/;" H` V  %`"aD" @ 24&H@>O d "x/! , , , , , , , , , , , , , ? %  @  ذ?@ ԰?&aD? %  @  aD@Ԑ aD@``@@ #H b :#`"#; b!D" @~ :@= ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? 8"c;  ;@> ;  m?@} i?"#H;"!D:c? "c;  ;@% ;  ;@d ;!Dh# #*@@ *`@O !A?$#:c "c;!D  #@ ֔ :c? "c;  ;@ ;  ?@- ? "c:c? "c;  ;@֐ ;   @  㿘# #  #? #: :c  "cURcX"# @ y  #@   @ m :c? "c;  ;@ ;  S?@Đ O?!# $" `"`$$$`## `#" @"#P 擒 "c:c? "c;  ;@7 ;   @v  㿘!# ##" `@"# `& `"`N1:);?-# &#@/ #y$# @ ֒  #? &#   @   '?@0 #? %#? &#   @ې   "@ `¢ #r @ 㿘!:# $# @  `#? $#;  ;@ ;  =?@ 9?#@  C@?#P "$ܒ$$`?&@" "?"c "c:c? "c;  ;@u ;   @  㿘  `;Z!`@ɔ $?#@ @" #ޅ `$c h &?@@ invalid mark character㿘e @   ;k!c@ ?#*` cԐ "cc* "@ 㿘e    c?* ߎ@ ;k!c@d ? Ԁ `*`"Ԅ"Ԁ`㿘@   >  %& @;P ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` *  㿘"  N \2 `?㿘;!L`] %: $;b!H@@9;@; ;d"x "x* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * ?$;  ;@^ ;  0 @ , "!L;"!H:c? "c;  ;@E ;  ;@ ;H`N \   * ;!H㿘:#  ;? *  "@㿘:#  ;? *  "@Oed.hupHOME㿘; ;w ;? * *@"#0l#[b   (l@^#࢒ #@4  @ @84J /" /.*`l@8Dc[b ; 㿘; ;1 ;? * *@"!P@?㿐8#;? **@" `h@ʔ   ;?"a$ ;?"aP8"#..㿘; " N ! m@_a؀ @S[ /   ;e!a@Ҕ  invalid pattern delimiterno previous patternout of memory㿘# J *;!m"X"X;!::Z2:   #Ȓ"#J  *;"  ;;m"x"x:; # ;<"@J:  "7 ;"` ;! !;@׾ ;!;@ѐ  $"@9 ;m"":#  3 ;"! !;"@ 2!; "";@!'@"$" unbalanced brackets ([])trailing backslash (\)㿘# @* : +);!'n`*`:   [ \`L@@` ``=! < < , L@ i`L@#Ȥ$@;" L :#`"#; b"" @ $;@9 ;m"":#  3 :c? "c;  ;q ;  B  > "";"":c? "c;  ;X ;  1; 1;!"#@"*$##` ;";!n  ;!:"2 *" Ֆ J^" J]" # (8 ![2 J `.`:`=2  J ]   J]2J 2J J]ކJ] number out of range㿘&@&# J "#G @V B?#J 9 J, : @"## ?ϐ  @M[  @&@#@ 8# " ;o!` @ &@?#J g2  #Ȓ`"#Ȑ & no previous substitutionout of memory㿘 "J % J-: @"# ;o!a@ה #$#J-: @ 3):+7;o!-;'5 cЀ N # %# bc" @T 2.&c@7 o !. `, `, `, `, `, `, `, `, ` , ` , ` , ` , ` , #? %#   %c#? %#     cK c **`: $Ȁ  J "?*`:  \'c @** : `$Ȁ  #P d!L "   x@J? ` ?6 u J-: @s  #Ѐ b :#`"# b#" @ :@7, ;o! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? "c;  ; ;  #   "#"#:c? "c;  ;g ;   "#c*cno match㿘c#"c # s ':);c %c@ &?Yc q y#آ@ $ ? j$      m?\ i?cڷc$ @ ? K$      N?= J?? $      "( c#c" c"#``;p" "* `* `* `* `* `* `* `* `* ?` #H ? infinite substitution loop 㽰'L'P ϐ#` ` 3 `' @5 5):-;!9o!+;P`@s$l U # %# bؒ" @j 24&l@5֐ !;+a`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` #? 2%#`  / ` H?o D?%#? %#`   ` [ #` $ ڴ ؐ@o@!` m$?l V# %# " "c@@ 24&l@5e !;+a`,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` #? %#`   ` װ? Ӱ?%#? %#`   `  #`  C ؐ@$ L L`   @4   P#@ #l b :#`"##ؐ "&"@@u :@4 ;o! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? 9"c;  ;5 ;  M?t I?"#l"#:c? "c;  ; ;   [   $ L` ;q!aH@m  ?#`  ٢ !#ؐ@\#ؒ@q!h !h*@@ *`  㿘'D'P## A3+:-9;!7o!/;N &c \`` "cl N c %c "ؐ" @Ē 2-&cl@40 /! , , , , , , , , , , , , , c? F%c >  9%c? %c  |  @ @6ԴD *@`@ ʴr N 0m 9lcl?P h * @  "cl Oc %c " "#@R 2-&cl@3 /! , , , , , , , , , , , , , c? %c ̀  %c? %c     @J @6bD *@`@ Xcl Oc %c " "#@ 2-&cl@3` /! , , , , , , , , , , , , , c? v%c n  i%c? %c     *@ #& #@&N #l b :#`"# b#ؒ" @ :@2 ;o! !* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :c? "c;  ;S ;   ? ?"#l"#:c? "c;  ;: ;  y #*out of memory㿘;#<;;#D@  `d"@* @ @(*` !;$#<#;cD*` * "ִcD#<*@ *` "֫cD#<*@ *` & ,$cD@2w ;t#8 #8* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` @* !;@#<$#<;"#@ nothing to undo㿈##;#H?;#L? ;;u!`@ ?#D  "cS :c "c;#D`W;#<+` *  +`   @@ < +`+` *  ` @" @  *"`@ *` `"`` @" @ *`@ `"`"` "` "``"``" +`@ *`  " ;#D `2  : *;#<;#D2  :  +` * ' ''` * @*` "" ""#P ۻ;cH""cH;cL""cL:c? "c;  ; ;   =  㿘';D??!$D);cD#<* @*` 2 ``@ @@Ő@D??$D;"#D;#"cH;#"cL㿘@Ԕ㿘@{  2" @ " 㿘@n   @/B &  @o  &㿘 @ @2  '"@&  J-`?2  e*8 ((J J 2 "@ 㿐 ̒  @@ & & %d㿘 @   @  v@d  && 㿘   `? J"  Ő"  |&=<>+-*/%:()㿘! 5 a  *"aL`&L   =v#@Iߐ "L  L <  > ! 00   /"a "asyntax error㿘 w@ɒ`㿘! ! !!  @!  0%sh! N KI`@5 " @&!w aX@ƀ  @. Ȁ ؀  *@ @"@  w !`@! non-numeric argumentdivision by zero㿘.* ؐ wӐ  w @)b2` @`&   w @b @`& @`& y! р π 㿘  w  w @b ` `" & L!  㿐Ԣ Ð A ?< :?` xx *` d4|L@4a  0^@6[  0X@&U  0R@$O  0L G`?A DB?` ;x!*` `(tH @z 4"  0 @z: 2  @z2  @z $  0  @z`? @z@ ! m k i g e c㿘Y! # O   ` {a 㿘! # ̐ `\a %d %s 㿘@sܲ` w@a`"!ΐ ! "@@ 2yy @ H@?r`@H㿘@ #lost+found㿘 * `H  @@ `" `  " `@  $  $ " `@*@@   ˜ @ *@  @J 2    "  @wrong type to dirscan %d 㽘M 0`" $y@K"   @¢D  @sm 4, D, 4` @< 2* @ * = ! @`4 @   <  b= 7 % @< &¤ !`@% ( @   @   "@, - @ 2`  4       DIRECTORY CORRUPTED㿘! @`4 @\ !7  4  3  (.  6* `@@ 2#  ey@+bc @8`  "6 " . . .  ,` "$  ~B?[<  4  V   R N  `@ $      b<  !=`:@  4  0@0 + ` a >"@""@ $ <  b<   y@*c @Ӓ`@ 6  ,`  " @h:: `- 44 21 @2 `+   ? `  `   ` `  `H  /   &HH`?㿘 @%s NAME=%s %s=%s DIRFILE㻐z#@.@ z@=#Ȑ@)۔` h@z@ː@%n <  zz##z#@0z#@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@ T .`>`  @ E{`@D 0?  @ <  2zz##;#{@ @ T ,`: { ؒ @='"   6 {z@=#{@ {@=!  2  {@%6!  "@4 㾐 (@ ,/    ` `  " 6  " 74   $4 !H # @, , ,    ,@ 㿘 (   ,@_d "  $!H # @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u ` @ 8@@<  `?"zz##{@ɐ#@  ``    2 {{@$P# ! @<"#! M@W ;c' /c'Ē '@ {1$ @#  !|@$&  $!;  @ $ ; @   |  ! @s $   z#@; 2|Z @  <  7|@H X|@# x ! ;  @ $ |, ; c@| |  @# / ''`d,`*`?:``d2@ !@ J@ | @  0R@# @a  | @ |@;u P0> d.  ?72 #!|!@4` 2 !€`@@!!@ ` @C4` ! d*`  2 |!@ؒ |!(@;E d.`  2    z@;8#Ȱ ` @ 8 /{#P'''''@`@ X B h>`<@: @Ԕ 8 /{"x'?''@C` @B*2 @2 2* @ * @>`@ْ  @'+@"@ @ƒ  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘! @qP 4߰ , ( "ٰ   !@&m 8 ͚+` , (# (" („! 0 : @ B >  0:  h ` & h`P* :  8   8 !  0!e< eD`L  (@; ` u,`@/"¦!@+`0` e,`@ "`"`0 );!#@ "` 0@  ,`*`` ! P*@:`    8 !  0 !e< eD`L  (@ ` ,;`c@ٔ }#0@  "}}@: #H @"0#X  @,` , *  ("(" (˜!  0 :  b>   0:`  h" & h @&`8 㿘@ϒ !H ;;##&@&` @ ! (@`4 4@ b! 4@@ %;!@r b` 4@@  . @4    d 2`@ ' !@ ? @ @@ @*@@J   d.  2@ ,@  2@ @  @a4 㿘@ @T2 @㿘 h`   @ 2 ?,$?@{ϒ  0,@  #,㿘# ?"@"="cDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ >`< @@@(@+x!%(:  8ܰ  !%( x h x˰ @%` @b> @8"@" P @ ! 0?: @ B  @p; Ѐ@^ ¦!p2e<@ :e@@ B `L ;  @ @m `T&` 8&`@ 2+&`N`0 26``2`@$ !@@ ! 2%`@`%@ `: @p`0: > @8"@n" P`N`0 `@ Y Q`Ѐ@ ! `8&`  0+  * :  b ; а p®!@ " N`0&`@6 "' 2`@$ !@@ ^! J t: @oӪ` d  $@ PARTIALLY TRUNCATED INODE I=%u㷐M`0  y`@ 2`0"`@`  ! ! `@!`0  0 : ¢!` t: @o  &`! t: @o8 ! t@ ` b: @7ɐ"@" P ?%v F@B@o `"T@+-! t6&*  - ¢9   "@&L`@$ " $- * L@!-@:59 `%`@\  ?%M`0 `@# !@ޒ@!`f * ?% blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘#؀ V S¦!@f`@``,@`` `@=!T 7!h@7@  ,@ @ !"@ ¦!@`@!T @``,@``!@6ڔ !@6  bad inode number %d to ginode 㿘  h#X@!Ā` ! x@ 2!@H @  ,@@  @y @8 x `* !D`!` ?"`! @`0"aD# @! x@f x$a!D!@x`x*  bad inode number %d to nextinode 㿘  ` "  h+ @`\ =#"#!@ @1  ,@@,  @x @ x `*  d,@y`aL  ##Đ %`\#\c̐ "\!!P @  "a! `"!Cannot allocate space for inode buffer 㿘"!" " \"#!e<8`H "c4 "#)`@8%!L%`@y$*  " %!L#"c#"c!  2 @# $ @"@  !\   㿘  "@" cannot increase directory list㿘! 0?:  @ B  @m;  8 , $ (@ 7!@x `p*   $@" $` $``$`$`$`$`$` $`,$` `$@4 ( Ѐ@’`d"! H@͓*` $ H@#  H*`"`" cannot find inode %d 㿘@w`p`* @     2 !8@n㿘   * ?`H #@k?`H#@c`!@` H$ H$`D (%s %sDIRFILECLEAR (CLEARED) 㿘> <  2"X"`"P@}@h   2@ "h   @4ݐ"pc?"c`x@ !@  * 㿘 ( @2   ,@} 㿘 (  @I , 2 `  h@8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐 @4 7 h3@4v @ۘ p  @ ( p@4i 0@4e  " @@4Z @  @4U H '@" X@4K%d %s I=%u BAD STATE %d TO BLKERR㿘!p@@42!!@J "   !@4€  0!@  *@!@ *@!@!@IJ@㿐  !@J ]  ’ h !@`hJ °  *J h<@ @(@ : @5 !@ !@ *@@  $ (!@ *@4@1$ $ $ ” 4 :<  4: $ hc "c!H #ܑ6` *@` @e 8 / ''֐`x@R }!@ *@c?"cdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... 㿘@g @K- *#!'%8+);#!@psx?z? +q* x$,x %, b`@q "#@2 , c`@b "caT %aT, m`@S p%#@  @2# ` ,`,  , ,`(!`8@ T#&* @ @   @ޒa0   @֒a  @@`  @ ?#䀢 2 @d-%c flag requires a %s 㿐@6o"J  p@ufsffsrwro㿘 @Fɒ` "   @F’`耢 2  @F` "   @F` 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** (   @a!@ !T   @!@?n    h@!e   !!@1``@ "@1X!@1U!@Q    "@Ȑ"@1D"8@  @1;"`@  @12"@   @1)"@   @1"@ %'¤!``!@`8" @ . * * @L (. "* *  (2`@ :@@ @t" #@0!T  Ȑ `h"@" `$@0ސ#@!T R'!``" @`,$`$`?`4@  $!@`8#ؒ"@$ `$@0#X!  @0#p   #c@0  2c@0#!#Ȁ @0##Ȁ  #c@0  2c@0#"#" O"!X ` ! ! @.?  , # *’!J` $ ` ,7°!L @D``,@?```d, @  ,L@R @#@!@@ d ` 5  2@03# P @0, @^ "! (@> W@'''  ( @     @0  0@ 0 ` ! ,>¨!-  @``,@``   @``,@`` :    ?$-@ @ @*     ,& !``?`4@    : c   $ +   *  @^ 8 /"T'Ģ " "c! ,¨!   6¦!`@o  `  ,& PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘@< 1`(’`@Q 0 `X’`@Q  @ ``  @ i@ !  ’`x@ !@ *@"#! 0 :`@ B B?` `  !T "{`` @.!t  <2@ϐ! ߐ! 4 :<` !4@! 0?: `@B @f;  `6!T "B!0@.| :@@((t#쀢 <`` 6 852`h`;0`h +#j ?#`!`( daP@+ "@ |!H!T  ` ,!``` @.9s`(@` $`h!%(: `8`` 8 `!%( !`h  ``B * 2`  2  $  ¨! @`t?   4 , @ (` T "@-  ,  􀤀 ¨! @#`t   , @ X` T "@-ʐ  , @ ~c "c d. `2 T` @ϐ  2"@ ,!@ϐ!؀  !@ גac""c`` !@ !@ *@!@ *@#ܑ4 *@#쀢 "`?"`$`p?4``$`tZ4`"!"a&`M! 4: @E`$&`$`h 0!@   @-N"(0@r"8 `$" h"@@ !!@ *@@_!` !@*m’`x@ BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘    % aȔaȔ  "a!@    @," @!؀  !@ a $3/-579#+€    u   :`cJ   ?$:@ 2 %  : c   ?$ *@  N*  b h̒ ` %"(@ %   @؀ 2> @ ’!@  2 "@ "@@؀ . @ !aX aX$aX%`"@""@`aX@ X`aX@@ 2`aX@2 $`2$aX $ & $~ ` @ 8 /"\' "aР ! ,+¨!+¢   @6¦! (`g "`'a@J   ` @   ,ܢ DUP㿘 `2`'-)Ւ  2 Ѐ !X  !X`X $ " $!X!X 2 !X @ բ`ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'!@ ?* : `l *` 5566|5\5@ #@@#X  #h@ cpr!퀢 "T@ #x@ ː#@n#   ]!퀢 "?@ o#x@]# 27#h@ ecp@ #@O# }  >!퀢 " @ P#x@># #h@ GcpJ  / 2 !@#@ 6J`!H  !@ *`#ܐ *`#!`H  @; @ 8 /#' * `H  @S¦8+¤@@  F   `"$ #!% @  0 @ I"` @* ` ! >$ `  p@     :  @a 7@  ?Hh $@U  ' '̐v`@*@ H@J+'%@ `"?`  ";`  6?4 2$   ǔx@c "(`  D d* 2  쳔@|c "` d*`  2  *` ?2  $   `@*@.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 #쀢`(@  h@# , `$   '@=a 2"``   ǒa`$@# " !H "a`$  \`볒aؐ P,`묒a`'!H  // /!7  @=` "@ɒ3`$6@"8*`$,`@6 7@$7@`$ %`$ d*` ?2  @4@@# " `$ 4` '!H  // /  7 `/`$   @y"@74`$ %`$ d*` ?2  @4 @=?` % !H "W  R` bh ,@# "G F @=a   ` x"@*?  `x@"?%  % `x7@L@# " `$ %`$` d*` ?2  "   `8 `$L .`$ `2L `b$@# "   .2`$`b %`$ h@ `D!H $   2 `   2`ꉔ( $ ,@M# " !@ @?* : `"H*` B`D$CdCdBB`$ `@_@'# `$ !@J@ 2#P  } #X`D@ # r!@<    *  d*` 2 {  &`$ $`@ @ #p@>  "@'# `$@̐# 2`$ `% !H ! #J @ `# @,@# "  d*` ? 2 !@#@J@ " $  @$$ 㿘 * ?`H >)+ `"3  !@J 2+!@ J $  ` !@J  `p@ `  $ $  d*` ?2 !@ *@ H:UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @ǔ 8 / 'Ġ #U'"#%'@ ?* :  2@* GGGGGhG d, R@`c. "+ c2!   @b8bH"PJ@@ "$c@ 0  #('ȁ㿘  `M '+)m   >  & $@Ӑ  :`cJ   ?$:@ %   " 2  2  : c   $  * *@*  ?% ` DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?bН!#?#H@?4 !@ *` @``5 # $eL`X e$   @[!P  2 %e$@ !p " `X%e$ "#*!`X  e$4e$ !`X@```!`"eL`X e$ %e$`* @weP*  ``,`: `@wv`@x`|`,`: e$ `0* `@wf``|``@xÓ* `,`:   !@M%e$  2@ ! C  !@`* @w8eP*  ``,`: `@w,`@x`|`,`: e$ * `@w``|``@xz* `,`: @ e@ B`L ;   %` "#*!eL? o! T?< ``"`: !@"U?4 eP?8  V%eP % T`, % X`@veP* % \``,`:  \ % `e$  `@v`@x$`|`,`: ! `@v`@x`| , :` `@ % he$ *  % l`@v``|``@x* `,`:  l % d@"U%  ?<  \ T"@ d" @eL@ @d  @  ,"*  * 0#쀢 2" , @N `$`8@     : c  $ +  *  `,6seL@"U @vF``.@vA`` 㐒 @ ` Ԁ"@ʒ@v,```$4% % `,?2``@g_`5 5 &% e$  @wp`8% p% % $% `% ( @6% (% (, @6% ,% ,U 0@6% 0% 0 4 @Д   T T @ǔ@eL??4 @u` `E "@ ?* :  ** SS SSSS   %  ?% :  " \b  ?$. @ *( @"(J@@`¦ " :  " \b  ?$. @* ?%   `84 ,`:`J ` ` ?"@: 2, :  c `    " .  *`8Ӓ`8]  % @u2`|@v` ,`T T @ "@@u`|@fb`@v{`@u`@fY`@u`@@fS`@u eP@vk`*  ,   X@teP*  4e$ <@vR`8 & :  l@vH`8 &` ?"@. @&,$ $% $:  " `@ @ ?$: `8" :@   4@ `8Ee$ 4  h l   p@ @ ` ` e$@4*`  #   *   p瀋@ ` e$@4*`  #  $ '  '  '  '`p> *`@ `l.* bؠ @E  @@]bH   $ $  $  $$ *!#耢 b` " \\ @D x@3bp \ " \ @}(?<@D   T TTT @D !@b ?<@}TT  T T @}( `,eL??8%eP`@D  @@̒bH  =`=`-`-` *a< |< <|<㿘'H'L'P'T'Xd"@XH@~ %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  <" <#@!b|@_ <"  @!# <"  <(#b|@!8@~] 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘8@ ]# ޒ㿘'H'L'P'T'X H@~) 8@ն / @L <  L  r @  /r㿘@ՙ / 1,!@ ޒ /,!@ aȐ!@  !ذ /Can't stat root Can't stat %s %s is not a character device x <""!"8@LY6"8@ "@0M@LM8  @"X@ @<  "@L@<b "b@L/؀  f"X@ ƒ"<  "h<   `g @ ` malloc failed㿘@y  @Կ`realloc failed㿘@y  @Ԯ`Hstrdup failed㿘@ r  @ԟ`vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead * T?"`LJ#Ԑ@J  8@#"@  <   "@"8 " @I €  "aP8@#"H@   "`@~J  @Iޒ € "`L?"`L  ""h@d"x  2@\"" `" ! !, ?$ $ #¢a ,`$`$`@wi$ @wf$`  `2t" @aP  (""c"l@Ԑ  Q# 2   2 aP@+0 "| @=" u \@%@oL,@@oH8,$@ \`@\@##\"b8#`@cF  #jc!T !#@J`! р     (M#!?  2D 0! $"c# ,@o $`h 0 :`*` * ?:   !  t:   @UA @ E $  !    X@ ` " ,  !  <`c @   "`<, ! `! @# !  `  "`  @Q   2 @p ’ *!*!<!  @* @$! !  ` `"`  @&   2 @E ’ *!*!< ! `0 `H@! `0 "`H  @   2 @!@ ’ *!*!< ! `4 `L@r!H `4 "`L  @ڐ   2 @!@ ’ *!*!<!e, e0!e4# ! e4e0B!p :%0  @   2 @ː!@ ’ *!*!< ! %(`< !  <"e(  @   2 @!@ ’ *!*!<!`H: : e8 !e< ' ! e<e8! H: : :8  @W   2 @v!@ ’ *!*!<!`L: : e@ !eD ' ! eDe@! L: : :@  @%   2 @D!@ ’ *!*!< "aHH: : :8L: : :@"!H# 4!%, 0  2 @"8 N v"c "c” "e,:%0 <"e(H: : :8L: : :@ **!<# i!%L?e  2 @"  ?"Xc "c’a` "L` "P`#\"T`%`"X`* @mP*  `,`: @! @ms @n |`,`: @!e$ * `@mb``|``@n* `,`:  ša`%@ B L ;   $ +`*!< ! L  #   !  @wh L@Ē ! =ª!``"`04 @Q`- @ "b!P` ؐ@m 8  d* @ 2`"@>"8 2"Fa` 0  ɨ #آ```:   !@Pے  $#"@0Q!#`h @P͒  $!@`h"!#`h @P  $#`h# @ג`05!#`h @P   $ d`h`#H@Ǔ*`0%%! $p"`  "c#@P $`H!p@P $ `H `  p#p@*`0@W 0@  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘#  l:  @O !Pa@ 2 !" "  %\F!T@` ! , `8! `P! ,@l    ,?@k `h! h@#֒`@k`l! !   d 4@m?, $`l@m;$ # * T!`,?@k``,@k``!!  @'`h!   2 ¢! ` ! "@` % "e `  "` ` `"`"`"`"` ""b`  *``  *``  *``  *``  X"`X`  <"`<`  "``  @"`@`  \"`\` "ؒb@uL |` #T"cT`  Ԓ`@uB"` $\d\@u< `  d"`d`  "``  "`` %P"eP` %H"eH` %8:8` %@:@` %H"eH` %0:0  `@;h &!T @J   h ?`)¦!@  $ @7:`  ``@  *`T %s: BAD SUPER BLOCK: %s 㿘   " E@!"%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@!/ ??" L ?? Le`  "hZ @Le`  "L`* :@ ``<"*` !("8e  @ut%h &4 &8 &&$`0&`,&`8&4@k?`(&|`` ?4@k7 ?8@k2@jw&?&` * :``& "* &?|@k ?8@k@jV&@jR@k|&$@k?@k &,&d|`$ d :``&d`("`l ioctl (GCINFO): %s %s: can't read disk label 㿘e`e@sƔ 61 8  @-#!P!ha!bad file type 0%o 㿘< @@"$  (@"  @" 0 @!T@  !T !@ INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘  "S"@,7b`?@ɐ" J  L "@_ J 2   dJ d#@M "@d!#@@hڐ`? $`@/9  $, :  , : `?  $`@/& 2 ` ,   ` $`  2`, :  y Y n N2@a", :  y Y  cannot allocate buffer pool 㿘"#"aD!@pc 0 2v!8#" * ?" " `(" "`(!(@jw`0$  @6'¬!/' (?@p= @p9 0 `2$ `G8$ ($(" $(, $ `@$ " 4deadlocked buffer pool 㿘’ ( ( ! d+– (  "  2  (  ’ (    2  (2"@ ` "` "@ "``(& `(&`(" "`(  & 㿘! d.@  L@!`X "`X!P @f& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` D` ` @i`l X ` 0`.`&```@` !@& ` !)¦! L,`"ؐ@h< 8   d*  " 04@ 0  `CANNOT %s: BLK %dProgram terminated 㿘  2@,"!K" V!UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘  L6!P L!c!J T /! :  l:  @J2€@   2" ! l:  @Jx!$  ,  L2 L!-##@n  ,`¨ ('€@ L`@n`@n @ 4@""@ʒ"@"# ""aD! р    "X "x "  ’a` **` L!T "# X, * * @h`"@Y`@q!P L@pSEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘> l: @Lָ @qS !P @p[ !X@q:  !PԒ @qŔ@!`>-7@ph /<@ E  ;  B  @q l#@f’@h @ha@Д   !@hl!@ƒ  Ȳ@@"WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `> l: @LH @pŖ !P_ @o ="``#P@p 6!PD@t# %#)@o`l`l <  D  ;  B  @p @g`l!@S `l@@K"㿘 z8v  1#8 @l ’ `8 X º@,8H@ >2?  6 @,8N >@ 6  @@,8@ * .@ " @ `8 @`8@؄ @&` `?$/?..`@ <2## ##  !@ ? # #. `J. < "# @p^ 8/ '#@-.#'#'#'Ɛp "<''cl'ܹ'c <@p#$ @o1? /,  <Ȁ2'<"#? ?,<@o& 㿘#쀢 Z @p( returning to single-user after filesystem check 㿘@;!` "c @nk 㿘@  @nc  @n`  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 %  $ ""N 0 M    "@!  "   & & "㿘=0 8. . @..`<=   &@>/`@ 8@/`@2 / #/./  8. ` 8@۰ffs_isblock㿘 8 "  0$ !@ `?*  *@>*  *@>@  `? * >@  `?#ffs_clrblock㿘 8 >  0 .@>*`  *` > * @ *@.@  ffs_setblock㿘 8 >  0  .@>*   *  > *@@  .@ Ȑ!hffs_isfreeblock㿘 8 ">  0 @`?>@*` @*` *  `?>@>  "㿘@/ /LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 ! cP@G@#`=""  #!3`#h@G  cp#x@`*̀  = c@GoX;" "" "`@% "  2` 2   c@GR`̐?"` J #@  #@   ͐!X@ "c"Dinternal error: unknown type %d.㿘̀  4  D;! =`"" 4="" " @`"@`@ 2`@  !@f0֔!J! #@:` #@4` " D" 4type㿘=b#8"`: 㿘=b#H"`0 㿘=b#"`& We only support %s mode, sorry. 㿘 cP@F̐?"`We only support %s format, sorry. 㿘 c@F̐?"`We only support %s structure, sorry. 㿘 `@FP̐?"`local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H   'D`"` D  DH@8X` D  DDH@8Mp D  HH `@F4   @:  H̐?G"``H`""`HJ a  耢     " H@ H"`  "Ȁ H@c H"`H   `@WH @@i;local-filesusage: %s local-files Continue withmput%s: not found`'D 'HDH@7͔Ȁ H b@E̐?d"`H"aҐ "c @ja '@}M#(! !%e'`#H @8 B N #$# H@9 H# 1J`@   J   "J  /@  *`@ `* **  2J" @  "Ȁ @  耢    b    @# H"쀢 Hb $b"@8c # $#|$b D %+)#Ѧ" K H, @@8@ b H@ H, @"Ȁ @U  耢   H, @  b  @C  2y "쀢 sb $b"@8[c  $e$b @k ,H, @, @ HȀ  H, #@ 0J H`D >H@80 9b "@ Q"Ȁ @   耢   @  b  @  2 "쀢 b $b"@7c  $$b 2@Ƞ DM֐ @i"#r+w㿘 @(w㿘A#X#X` !!8@ usage: %s remote-file [ local-file ] local: %sRETR㻘'D'H D   'DH`"` D  DH@6p D  DDH@6 ` D  HH a@C   @7Ӑ  H̐?"` `B`# =``J`e @  2 JJ   "J #`H  /*  e`J`@  "*`@ `* **  2JH"`` " H@ W H"`` "Ȁ H@  H"`#H @8  AH!@`+@(:XHH @7Ғ  H H   !`@ A  :#X@@f㿘@;  ? " * " @ @^ # "쀢 #b!" $b$""@6a $b$"ѐ#(@z֒ """""#ѐ#(@z͒ remote-filesusage: %s remote-files mget㻐'D 'HDH@5 H b(@B̐?"`H"aҐ "c @h$a '@z#(3%e#`!!8!Ha@5O f N c&c H@6Q "# N     b*   +@J+" @ R "Ȁ @   "   @͚ c "쀢 H" $""@6b@ c &c$"@g"#onoff ؁Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %d. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Macros: %s 㿘 䀢`̀ !"a@A0!(@`! @%   䀢   a8@A00!`@`@$ ͠ )##J !ax@At!' 8@Akaa͖֔X͘ @A_cP 4"""a@AH !xb(@A;#p@A3bP#"bx@A&"  b˔@A"@%`"Ȁ   bȔh@A%"@`%!##tb@@a!ؔ@@c0#bԀ #H@ bԀ̨'ͤ!, * P@@ϔ bԀ&, " usage: %s [ on | off ] %s %s. 㿘  `? & `@ `Ѐ   & `@ `؀  & c0@@@? !9 cH@@Bell mode㿘֔("`Packet tracing㿘͔|h"`usage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿘  a-`?  `@@9@>?`@ `Ѐ "`@ `؀ "!@HR` 4  `@@` ?"!֐ "a1!! @@ `!  a@@! @`!"`Verbose mode㿘̔4.p"`Use of PORT cmds㿘֔"`Progress bar㿘єt "`Interactive mode㿘є8"`usage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. Disabling gate-ftp mode - no gate-ftp server defined. 㿐  c4@  c>`? `@ݒ`Ѐ 3  `@Ԓ`؀  +"#!`@ i ?#@J   c`@?S̐?:"`2!!!``@ !`, "#Ґ "c# # "J   @?0c"# ##J !ax@?!c" Globbing㿘֔M"`Preserve modification times㿘єp98"`usage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐   b@>@L?2+`@)`Ѐ 2`$ @ `؀ 2`"!@  J   b@>`$?"!a`?"a! `( `( ?"`(#!4!`b@>!! 4  "`remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'D  'HDH@0aP D  H `h@>H̐?$"`H @``` !` 4 ͐ @?`H @r``֐ "ausage: %s local-directory Local directory now %s getcwd: %s㻘   ="&`   a@=@`@1` ̐?("`@N`  !@a`̐?"`@$   a@=ܔ"@L`" `@a'usage: %s remote-file DELE %s㿘'D  'HDH@/Ŕp D  H c@=̐?"`H#0@`mdelete㿐'D 'HDH@/ H b(@=̐?I"`H"aҐ "c @b’a '@u#(3!H @/ - N c&c H@0 H#0@c H"쀢 H" $""@0ߒcȀ c &c$"@b"#from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'D  'HDH@/+X D  DH@/h D  HH ap@=̐? "`!@H` H!@A`-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`   "x&`   b@<@@@<b ""`@0bx " `@0` 2`̐?2"`@ bx `J |@0` "@0+` ̐? "```8 @ؚ @W `@_@_Ґusage: %s remote-files local-file mls㿀'D  'HDH@.l D HDH@.``  DH `p@#@}`0CJ ,` ]"3\   "( J 02JN ! @+`J@  ϓ+`  @    +@ + J  [+Ò"`J"` 2 Passive mode㿘 4 ! X8"`Store unique㿘͔H"`Receive unique㿘͔x8H"`CDUPCDUP command not recognized, trying XCUP. XCUP㿘@ &"`` !` 4 "@`@ "`֐ "arestart: offset not specified. Restarting at %qd. Execute get, put or append to initiate transfer 㿘 ͐#P@`0 !A@<` :<#X @4cpSYST㿘@ Ґ Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘'D'H"Ԁ 2D̐ 0  DDH@&C` D  H `p@4*"  @2`!"ԑ*` * ͰaH`@ "ԑ*` * * "Ԁ ͐"*& ͐ @`"  $Ԓaԑ* *  ?" "" "ԓ*@ *`@ * *    "` ͔"ԑ*` *   ѐ"13d#daͨ!%Ѧ"`? &`@ya  $a耤?, :  .ԑ* * ` ""`N? ". 2`3d! ? & @Pa  &a耤 ?2 ? ?  & @;   a  ` &a͐ @`̐?"`filenameusage: %s filename %s %qd 㿘'D  'HDH@%c D  H `@3J̐?"`H @'R  ?̀" H `@32" %s %s㿐'D  'HDH@%- D  H `@3?H @'o ?'!H@Ő@ a@2`"`STAT %sSTAT㿘 "h"p@ 4`Local file "%s" is newer than remote file "%s". 㿘?8  b`@2`PAGERmoreCan't allocate memory for $PAGER|%s㿘'D  'HDH@$ D  HH `@2  @&  ̐?<"`@Vv#( #0@YJ@U  2 @c8c`@B)A#X '%4$4$  =#XH! @ @U< =#X$$4H @@U?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitdisconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'D'H   DH@#  H c% "Ԁ@Ͱ!!H,`@*` @@W "Ԣ`@H"Ԁ@0H c@1P̐?"`@`͐!,`@*`@` `)e5ի,%/̶!N N  2  X*`:  $ \"F EN    * * :    , @*`*: @а N  D?"?H,  @`H N  i2 DH@@H@W@.@`N 2 N @v.@ @=? #@L%2L  #   䀢   @?9% 4 @ @9N  ਟ€@" L   `?"``@* "@@ @M0@$ 'D 'H,`*  2 ,`*  24ND́Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. Invalid IP address: %s%s: %s%s: not an Internet address?Invalid port: %sCan't create socketCan't connect to %sRequesting %s Requesting %s (via %s) GET %s%s HTTP/1.0 Host: %s /Writing HTTP request200Error retrieving file: %sContent-Length: -Can't open %sWriting %sReading from socketSuccessfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s`?'?Ȅ  @摐?І ?Є? @~`ȆІ`@  ??ЄІ`@    ?Є  a?І@~@ / `L 2 ,`!  `L  `!H?Ą @%?Ć ?Ą `J  ``!pΒL@?Ȇ   @~pa?Ȅ`@}  ??ȆȄ`@m  !?ȆL  /!,?@& / ?L 2,?Є@ : ,@`!   a?Ć@. @U  /Le`   @,쀢 `U"@T 2 8@2#" @0I B"(@@TV `L@ ?cؒ @} ?#@?#J  "H!!P7  @ܔ '䀢?@ϐ"`0@` ??"x@Ò0Ȅ  b@.A ? b@.9?#?Ȇ@"" @?#@Tܐ@S@Ӊ"0!?#@ @T耦?@S  N    ?c */@>  c@T}  #!?#@ @T耦 @SP  N   2` ?  ?#*oJ  #`!Nb*  R  c2  #(@"  "N N bN ( @ ?cԀ F' *!̢ ?cԒ @ : <  ?5` 0?#J +?̐??: ?Ą@ c@ ?Ć&@"ה!?̄  #HdR"N?̄ ?#"@@d#耢   ?#@  @ @R@Ra?c" Մ  : !: @"W??#@5'@R G @ B >?̆@R{? "ֲ@! #t ݒ`?"``@* "@@U #! :@ D #`@@H*0! I`#t D`Ւ  4 <`` 8`!: Ւ   ` ?`"@ # #* "@   ? " * " @ @G `@#h0A@!  4 #@`?c  @Q@R-dR"N?̄@?@R" ?Ȇ ?@O?Є@O( @Ѿ#0#X?Ć@0#@Ѱ䀢??@Q?Ȅ ?@O?І@O? http fetch aborted. 㿘@$s !!@2 @Gp ː#@cْ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L'@c{ P    䀢  . @Q c̐ @Qc@O!@O! 7¸"/Dܑ* H@ : w ܑ* H@2 @zb`@   L?O0O`@  U L?=0= @ /@b0 "B N /  @2 .ܓ*`"8H@ 0@ђ @ @b0 J@ /` J@  :ހ *@`ڪL ֠ @ :  ,@y : L 逤`,@``L@  @ / `*@ !  #\#`’bH@*3@ sb` 7b`@ᾒ 䀢  R( 8'''耤  L `'' `&̐ @X& 䀢   @Ԕ 2 "x@-0'"'' Z! } "@ L@@Ib@  `L @=b 2 `L@ ''' (! K"J?L D? 4 `"̈́’b@*h ؐ$”Ȗ@ "''䀤'耥` L%"' L % ''`  @G d ܰ @Mܐ '܀  䀢 ? %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 !͐"ؒ@PÔ @tb܀ "ؒ * !Đ#`@M #`", @ 28@s#Đ!@:̐?"`" *  @@O !Đ#`@, #`, Ēc`" 0 "ْ @0 6 @$!̐?"`2"Ͳ")8-̪?@  71  +#`'@b%#@!`$``@OW  #`'@O@)za@O4` @ 6ѐ@!s%@ߐ!l% '͒a@@   @А"D'  @՘  6@"@ b0!$!@ b8"" ! `2@Ο"@ 4  ĒbP@))0@ ! "@ " @ {̐?"` '?c!@   ! @v"h 0@N 㿘@!C  ? " * " @O @D4 AcP "cPA#T ͐!@` ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘'H'L'P'T'XA"#P! 83Ő"@`HŐ#@O:  Ő#@`͐#@O-   Ő# @`@0 ? " * " @ @C "   @א#0̐?"`( @Mbh!" @(ΔHŐ#X@m" @C" ֐ "a@͒c`@&`?A#P ` @  @M%c%c%c421 Service not available, remote server has closed connection. %s:㻐'D ժ h@N$ @Mdbh')97;/%  @0!  "?@0!   @0! ƒaH   @0! ƒaH  @'@C< 0`D` @M`4 Ɛ!P@@C*!%   @``4 4̀?8 57``3  4 ` +` , `` `4 2 `ƒa@'0`? "`` , :  @* "@@`e    *` * ?А% `  " `  e   2  `  )"-@-@`-@ ` - 2%  "D,A`4  ? 5 ` ``? "`` , :  @* "@@ߗ@B}`$d8$!̐ @ ,  "#" 1,"! @LQ !A@mA#P  Ő"h@`"?П@  ?`'@L4 %  㿐''   @r send aborted waiting for remote to finish abort. 㿘@ "#A"#P!ǐ"@ @B ͐ @^| sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout'D'H'L! :?ǐ#`"b'՘  : ̐??: #t' 4 ` LK@ - ǒch@&h L  ǒcx@&_ ! DH@ L0J Dc "' ' ''x't'|Đ"8'p@] +! 1 ! 1A#L x@K?&#Lx`"t@Kn t`"|@Kh |`@Kb "#t @KZc 'x @KUc'|H@c Hd!'\"#tK |$H @K@ 'tH`@ab0 'ǐ#@` @K/x @K,t @K)|"#t*"6'@b0 'ǐ#@EH @Kx @K|А#'S @CĒ <   ǒc@%H @Jx @J|@ o: @ ͐ @Jx @J|t`@Jܐ ̒?" z"#t@]4 < A#X#X` ED@c D@cȀ :L D  ?Ac\@   ` AS c\cX@K ` 1Aǐ#@HA  :#X#Xǐ#` A  >#X  :#Xǐ#'pL`ǐ#D ' @Jyx @Jv|"#tǐ#pD  @Jix @Jf|"#tt`"@J] `@0@0p '@5? @JL 't D #  8 "#7#S @Jr$ R>`ఒ@ B >రS`@JL ֲ&@`! #t # 6S  #``?"``@* "@@  #! :@ B ?ఀ   ߖ #@@?`! M`#t  D`Ւ  4 <`` 8`!: Ւ   ` ?`"@ # #* "@ɒ  ? " * " @ܹ @? `ǐ#@ɻH8#5Ր @-p` U-1 45   # @, # `?"``@* "@@| #@?b ! :@ B ?!  #t ` ` @0 `?"``@* "@@Q `B >`? "`` .`:  @* "@@8`B >! B#t  ;Ֆ  @  @ ?`"@ # #* "@  ? " * " @ @>  @ǐ#@H` @ 8# @#Ր??:@ "#t`@@4  @Hx @H|t`;@H 7Ր @Hx @H|"#tt`@H ! 1A̐?,"`#L &@H?&#L @ ̐?"`` "՟@Ւ  ` @  receive aborted waiting for remote to finish abort. 㿘@G "#A"#P!ː" @ @>@ ͐ @Z receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s'D'H'L'P'X'h'd'\! :?ː""b՘  : '̐??: #t'p#p'l@b`?'   4  H X`2J - ǒch@"pHL  ǒcx@"g ! " '` DH@L0'`'X'T " @ '@Y (! ! ! !A#L X@G?$#LX`"\@Gv \`@Gp p"#tl"#p @GebX'X @G`c'\X` H@c fHK |bH@  TH@ /8#  ǐ#@lHk  2,H "ː"@   /,`ǐ#@NHM !x 8# H@v! ǐ#@9H8 !x 8# @H  'H) !x @H 'H   D  z 0 Dc  q L@ : @  ͐ @FX @F\̐?G"`@Y)   A#X#X` #Ѐ 3L` ǐ#D  ! ǐ#D @}"0 'dX XH@ɒc  Xd"@'h"#t2"#p`!HHK |H @F 'TH`@\גb8  'hǐ#H@Ơ "#t"#p*"@?P 'hǐ#@ƎHА#'`hS`@?  Ő$' `@ d !@DT@D) $ d@i"n" `"``<  "#t"#p@? D "A  AXX @ hS X\@G  8 "#715dS`d@F@` MhS d@F!@E<  @ B > ! "#t #   #`?"``@* "@@ #! :@ B ?    ߖ #@@;! M #t  D Ւ  4 < ` 8 !: Ւ   ` ?`"@ # #* "@؜  ? " * " @، @;q @8# @ŋ"Ր??:@3`.ː"@rH0+#X#X  / h@     @(h? "  h @  7ǐ#@WHp"#tl"#p``@h071Ր 3@(d? f  'a  45    #@,  #``?"``@* "@@  #@:`! :@ B ?!   #t   `B > @(Yd h  h` @2 `?"``@* "@@Ґ ? h`? "`` , :  @* "@@׷ `B {> 쀢 ! ˒b@=ː#(@K ! B#t  ;dՖ  @  @ ?`"@ # #* "@q  ? " * " @a @:F d` @ 8# @_"Ր??:h @ǐ#@SH@  p"#tl"#p`` @h @DX @D\T`@D  @%d   {Ւ   ` @ #p iА#`@dL@ ?_'t@p 'xt'|H@Vx?T!@Lt@ ˒cX@H0Hp"#tl"#pT` @C  @C ! ̐?,"`@d̰?" !A#L `@D$#L``h "d@d "@Ւ    `  @-  @CX @C\setsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! setsockopt (reuse address)bindlistenPORT %d,%d,%d,%d,%d,%dp  ' 8 n  @v A "cL@i!  ( ?A#Lc @i  6@U!`&!x 1   !A@C#L?$#L" 8& !#\#`Ր hВa@t"܀ А!@`!A!͐ В @D  А ,  , (((, , A#L@奔   @ !!A͖͒!@!@"`"`"` " !؀ 22A#L?" @C5  @ A "cL@!`!؀ A#L?c @ A@А!m!A#L͒`@  @Ð"`!A ( A#L?c @Ę  6 @°!` 'A#L͒`@ޔ؀ A@¢"?!A#L@p  !@—"!!؀ ̈́ #\["   !؀?$!w "@ `֐ "aؐ 'A#L  @y   @e"  @B#L?$#L`֐ "aذ accept㿀 ' 8 %A!A#L@q5䢒 6 !A@A"@B#L?$#L @B#L$#L '  @>  6A@*"A#L@㿘Ւ  ` @ 㿘@ AcP "cP㿘A"#P @AԒc؀  a ǰ!Ţ h  "aa Ű hǢ!"a`&@"` 0` @֔ .!. ̐`"`0͒&!`&!`&!` &! a"a"`a"`a "` ͒@@&!`&!`&! ` &!a"@a"`a "`a"` a&!$a$"ab &!(a("b c&!,a,"c`D&!0a0"`Da&!4a4"a`&!8a8"`ax&!<a<"axc&!@a@"cb&!DaD"b!H!˒#@z .!X#@ԒaH!Y!֒!@q .!i!@˒aYb&!lal"bȐ!p!Ԓ h@c#.%o h@ҽap%p!ђ#@Z#.)o#@Ҵep @A.AcP "cPĀ 㿘@'  ? " * " @3 @7 ` "`"#A"#P͐!@Sy STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborth'D'H'L''!@ " " '!x #hǐ#'#   @   x 2  D"АC !x Ґ#p@p`0ʐ  䀢  Ґ#@c` ̐?"` D  Ґ#`h @R! : @@}b'ǐ#DyL  @@r 0@¡   'ǐ#eH  !A#T $#T    @@Sx $#T ҒcH@L0@@F A"#TD@sb !  D@hb  !!  R!!   ǐ# H i0! "@ !6`?!!  ǐ#H  # ! F@ 0B! "@ !`?! ,А @An ! * : 2*:   *@ @$  6@# ̐?"`@L J ! ې ِ  ̐?"` @?́resetxؒ @A, -֢ت )'̤?R 2 * -@@  $@ ` @ @$   runique: can't find unique file name. 㿘@ / @ 1,@@`"ː"@& ` /,@!ǐ#@|< ͐!@`5 #H@Œ@@#H#H .*'`1ɠ 1  d,,@`:  9,@ 0#H@ ,:  02 L .2 , ," 1ɰ#HLost control connection for abort.%cABOR x" @#( ̐?"`@ƒaH  @f " R  @   !@ #!" ԒcP@ @4" ؐ @@] ! * : 2*:   *   $  * : 2*:  *  $  4 6@ؐ# ̐?"`@ V 2`*  `:  V @>͔$ 4V   "(  ftptcphttpFTPSERVERPORTbad FTPSERVERPORT port number: %s (ignored)ftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegino:pPr:tvV-bad port number: %s (ignored)-r requires numeric argumentRetrying... x'D@&'H Ր!p@CÒax  2aTՐ!@Cax  P 2aP2!@<! @槔 ?#@J Ր!@!2!!! Ր!@Cax ֐ 4! 2aְ """"""%$8#$`"#p" 4"#t"#֐$@"a"`@ ؁ sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 ! ? " * " @Ζ !+%d !)"쀢 " `@- @1k `$@l耢  ^@<͐ r L dƀ`j , ؐ @ `? $`@  $耢` R2`O @ " @M? !2N  !   䀢  ؐ!8@ ""   €@" " N    `?"``@* "@@   ڐ T@{͐ @:c̐ @:ܒc  /   @d@ $dK@ J@ `JJJ@`J2  "  " ` ?㿘Ր "`HҐ#"b" < " " %͢@@ ` $`!$ HJ@! $% <J@< <H HJ@!wPuX< <H J@ "` G<`<  J@< << < J@ ", "& % @\2 @` `*J@ @*` J@ "2 @ڒ`*` * ̀ H< 0 < << <  %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2:?@!͒ ! #ڔ @@gc@!dA"* 31A@!d  a L @ "* *@ @ 0"  %+)'ڲ`@? ` (@+?H @$ ? `usage: %s [-adeginptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘(d"ڒa8  @ @:ؐ macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8'L @7J"ڠ"@: # @f ?ڐ#@ ڒb@@icʀ  "cH8# ڐ#@} @ ! &/@儒 . -ڮ# #L#%9)ͦ!@g B  0 ?7e@Y @t 4`0@o /`0@X . "@e `0 @x$ `0$M@ @@ . @M à$@a M@ 7e@    "&@    x? Xܐ x@ @  @9v@5 &@@}0@*L 2-0Ҁ @!c(  HR @0  ?@ L @9ML@5 L"HR @0  ?@ @ @93L@5 '@@:L0! @;H   2"m#؀ { *` * * @H   ,`` e  ,@ H ["Ԁ "͐"$ * @*`@?"` -%"ԕ*` **` *   " "ԓ* @*`@` ѐ"Ѣ"@H0*:  ,L? ", ѐ"ې X@ '@PL0 @M#8#@A#H  #͐ (@` @2#8ڐ#h@.@%#H?㿘#H @Y !@#H  ` `,5ʀ`"#L!@t#H%`"#`\2.@j#H. . !@a#H` ` `  `, `\2.@Q#H. .J#L B  P P " !@#L "    stringlist: %m㿘@4 2&  @`ؐ & @4z P & @`؁㿘   2& @4*` & @j` * "  & 㿘  `  .`@4p ` @*@4i@4g㿘  , @   * Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number '%s'. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿐'D'H 䀢  ݒbh<0D  ?DH@uD? H( # !!TD $H @U ?#@J  !H ݒb@=H ݒb@6̐?"`# # " J 2Ґ @_b*`#H*` &2` # Hݐ#X`  4  ݒc @͘ " ͔Xݒ#H #H*X `* `* `* `* `*"#" D͔ݒ#P #P* `* `* `* `* `* `* `* `* ` * " ֔ݒ#` #`* `* `* `* `* `* `*" єPݒ#h #h*P `* `* `* `*"#x֖ݒ#p #p* `*ѐ "b"̀ H  @ ! `4?"`4א#x "̀`1̲  @Ւ  @В  L? ."? , ݒc@n 2,̐ ݒc@5  *! ̐ "`x̐ "`@"#͖Xݒ# #*X `* `* `* `* `* ``"* ݒc@< ! " x" @`̐ ݒc@5Ô ݐ#@4`" 4anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'H'L 'HLH̐?"` H L ,`# & @5!  @5!@T  'H@b@ 2ߐ!'H@֥!! ߔ@vH'Lߐ!'H`ߐ!'HH 15'߲@T  @bs@ 2 @db@d O@ec@5D?.@O 2'H'HH ߐ"H L 2@Sؐ"'Lߐ"(L   @SȐ"0'ߐ"@ ߀`啐"@ @"H`2B # \ `!  04Քߒ"` "`* `* `* `* `* `* ܕ@ ͐?"` "Ԁ5Ͳ!1͓, @*`X@솒@ Ԡ "Ԁ&,  sorry, arguments too long. (%s) 㿘@4 $"H@`K bh@ Ր  * $Ȑ"@d@d耢 25մ @4 ?N ". h @& &@4  TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘# " !B?"# ̀  @$ " Bc ""c`"` ""0 ̀ !B@12#p #x@4J? /  $d @D ?@# @?L@ /" /,@ c c*< *< *< *< *< *< *< *< *< *< *< *< *< *< @ #@rp @2`4`4?"`4"!`"!!T`?# #!c '  # @*& d ̐ &`"!-`?" 4"!@Ւc!B$ @? ̀ 2!B  @ŷ`  (o&ʐ#$@cw ̀ @ c$ ̐#@ 2.1ʰ#%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘" G" 2D ! ` @ [@' $d@c0耢 O1 `b*  R  n")  p a  y "" (@E` ֐ "b `@@ ( @ #`h!Ͱ %s: not foundh" Ȑ @2 ,, @Kٖ Ȁ  !@j@O; @&@O4Ȱ SIZE %s㿐̰??! 4?"4,"x  ̐ @- $ @{  J`e @  ̰??" 4!  !̐ @  @^ " 4MDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H4 ! ?"4ې# =`#\#`̐ c@aȐ @2Q ,''''?'8'ܐ?'@h?쀦`!   c@ X!  !̐ @Z  @ ̀?" 4" 㿐1B Ѐ?2 @_)& а  `w@0ʔ?B В@ `?㿘 @J  KMGTP %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETAh?!ː#@^ ˖c##"c"A#X:@P #t ̒  4` ~A cX B5- -@B2`* @ *`B2*@ *@ ` `& d4 d!@I"Ф?․@&y@'ؒ d@1;@@18!"@"#\"@,$  a" ,4  <   2a" @1@1!"@!J`  B#\#\@˔##"@'"@`''А"@@'˒##4`˔c"c":# ˔ccȐ "c "'˔##Ȗ"@'"@`''А"@@'荠셠B؅čB?Ւ  4B` B؁̒   `(@0@0!"@@~à @0v@0s!"@@nQA X@ b @ ?@  ؁ Ё؁Ɓ@'@&. @0N@0K!"@@E@0@@0=!"@@8@.@00@0-!$@&’ <@ <@ R @0@.?  @.a@ @  ? " * " @ @$ %qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d  4  @ ˔##Ȗ"@'"@`''А"@@'荠셠B腠čB?x@ ; BxB3? ?@  4  ՠ զ    "!"#\x  @ ;` BB B ;h!!#p d@e ]Ւ  BV ` R xK GA cX B̒  4= `6A X@ b @?p@ x pxƁ@'@%.@.@/@/ d$@% <@ <Ж@   R @.@-㿘  ,@.@4 *  ?"@%| "  @@$˒ P/͢ @6I@$* @ @@#   ? "* (" @X $@.6`   ?`?"``@* "@@< & `@& 㿐 R `h@-Y? P"bЁ㿈'''' @[㿘@ -%c %s -%c -- %s 㿘@ T "c'8%!@``? @я@ы#@ц#T#%!T#*`@z@ # $#@r#@.J㿘@l-link2link2-link1link1-link0link0EtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangeipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisoipxnsatalkinet-a-A'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRH@J @ ?`@@Zb8 2@ @Rb@  ֠  "#l?`#p@@6 ? `B#"cl# @5@ ֤  #l *#B"!  $ @ u @+@- !֐#֒cp@  2֐#@ @-} @ݐ#  @-v 9?#B#b  b@@ "  2@ 2 #X 2   "? 2 ` 2  bH@U@`?`@€ ? Ͳ`B!   <"5 6"@1" +!֠" А @, " !֠"  @+  @+ "  @ܜ " 6 @"`@"0" cp@q "@+ B8# 1# B@e"xB! cp@S "@+} @R"@,Ɛ 㿘C @?@+" @F ր "bC?"`@C" @socketSIOCGIFFLAGSSIOCGIFMETRIC㿘B!" ֐ @cP"0a@+> @#X?V "b"0a@+. @#h"#T "cT mallocSIOCGIFCONF%s: no such interface p ! B!"/@cP%#0-'@(ؒ ' @8a$@*  @@ , /Ф }-֐/ `  @+̔  d֐#p@ט   2$% $` $` $`  $` $` $` $`''''''''[Ѐ >@C  8 @+  23`2`-% $` $` $`  $` $` $` $`l B @  ## "   ,` @   2   @("  d"`P@p@+ 㿘cX "cX# ֐ "b#l#:` €2`㿘#l € 㿘#l € 㿘@’ b "b""B"!㿘#X # ր`6"##l`` @*A ր`"#֒ ""B"!""Note: trailers are no longer sent, but always received 㿘@` ȁ㿘#l € SIOCSIFFLAGS㿘"0a@)Ҕ !֐ @kcX#֒cp@֗ ֠#T `" "b@"b֔"2" @)a  @Ha@SIOCSIFMETRIC㿘!֐#֒cp@l @ͣ#$ " a@) @f" %s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d㿘"@Ӓcp"b@#T`@Ő# d@? "@ * "@ @  #l B @ 0##  ֠# ,  @   2  inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀 "  !8# + @cP##֒cp@Ĕ ֔##''' ''@@X 0#cp@կ "0a%@(ؔ# 8# 1@ @֐# @* c"#<" 0֠c"c$ $ $ "0a"@(? 8# 12 @)ݔ @z P֐#֒cp@k '@ʐ@ ` h@c<" 3֠c"c$ $ $ "0a#@(x? 8# 1 @) @B x֐#֒cp@3   d'@@̐ d@? "@ * "@ @ SIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈 "  !8# + @cP# @)R #֒cp@ "0a!@(# 618# 1 /2 뀦 f֐# @)6 1@Ӑ#1֐#֒cp@Ĕ ֠# @)&  #    @Z " '"0a"@'ڔ# 8# 1 @) @ P֐#֒cp@ԕ ֠# "# @0 "  ֠# # @# d@? "@ * "@ @k  ns %s 㿈# "  !8# + @(cP# @( #֒cp@P "0a!@'y# 618# 1 /2 뀦 h֐# @( 1@>#1֐#֒cp@/ ֠# 7 7 7 7 7 7@'@"P" 1"0a"@'@# 8# 12 @(m @  P֐#֒cp@ ֠# 7 7 7 7 7 7@&Ґ@ˌ `d@? "@ * "@ @Ԓ B ipx %s SNAPframe %s X "  !8# +А @cP# @( #֒cp@ӯ "0a!@&ؔ# 618# 1 /2 뀦 ֐# @( 1@#1֐#֒cp@ӎ ֠# / / / / / / / / / / / /@)@ " ="0a"@&# 8# 12 @' @] P֐#֒cp@N ֠# / / / / / / / / / / / /@)@Ӑ ` '!H' '!@'Đ '!8'̐ ' ' !7'!('''` " ` @ "``` 2@``@ʢ d@? "@ * "@ @ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh "  8# + @~cP @'( 0֒cp@һ "0 a!@% 68# 1 /2  iؒ @'  @ PȐ֒cp@қ @(ސݒ@9 `"0 a%@% 8# 1 @&  @ p @( @ " ""0 a"@%Ȁ 8# 12ؒ @&Ȕ @e ֒cp@W @(ݒ@ `d@? "@ * "@ @> %s: bad value㿘C D.`  `, ,  @I @[t @@% 0@,| "  @* $ c@O%s=%o%s=%x㿘  N 2. .`#. #@ɝ2td"@?`"@ < <* "@ N`K. 2 #d>@ ;  ,b@`?"``@* "@@ ,* :  % d"@:` ?`&  @  * & @* :` :`NN 4N`d"@?`"@ > >* "@ AppleTalk does not use netmasks %u.%u%s: illegal address㿐֠b0 , `*b0 @Naab @UW  ` ?#@   b(@NF4 , %hu-%hu%s: illegal net range: %u-%u㿐 {77b@U(   ` @ ֐ b@N#`2 2 12%s: illegal phase㿘@c ֐ *c`@ c  ֐ *c`c@M atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘 c` ֐ *c`֒#``  2`2`c` @    @g c`       @M`h֒#`#`6 `6 `6 Attempt to set XNS netmask will be ineffectual 㿈C T.`  ,  ,#@@$" 4 4 4 4 4 `4 @$!PAttempt to set IPX netmask will be ineffectual 㿈C d.`  ,  ,#@@& , , , , , , , , , , , , B!`4 @"㿘C t.` @&, @# `  ,, , , 㿘@^"c0Negative NSEL length is absurdSetting NSEL length valid only for iso㿘@EB "a @Mcx#l " R   @Lc B* 㿘C t t  usage: ifconfig interface %s [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ metric n ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A] [ af ] 㿘d"`p@)@$ 㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess arguments`@N@P  @ d"@a@#ː @" " d"@Ւa@# " @ @P  6@"@א"( +@"0+)C#%C !@bH`f`s%!0$,@"PT#"@"h" @L  #\ #`#d"    @? "0   @8 ! @3 ?' #\#`#d #h #l #p #t#x    @8  @" ''' @!ϔ  @!˔ @" @" @"  C@!0 㿀'H'L'P'T'XH'? `  '''@! `#####Ȓ8  ` *##("#㿘'H'L'P'T'X @>H@t@ 㿘'H'L'P'T'X @.H@d㿘'H'L'P'T'X @ H@V㿘C!4 `"!4@ fatal signal: %s㿘@ې"@L @#`cannot get kernel security level: %s㿈 ' ' '  @"њ ? 8@Ļ##?cannot change kernel security level from %d to %d: %skernel security level changed from %d to %d㿐'DD ' '   D@" ? 8@Ă##xD0#eD㿘㿘  @ `@] can't open %s: %mcan't get %s for controlling terminal: %m㿘@N@ @ ?!@" @?! @" Enter root password, or ^D to go multi-user /bin/sh-sh/dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: PATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting!?!'   @{ O"@>+"@jn"( . *(J # a@ߔ ,'1@?ڐ L@ @! @0 @!4 @ R"(0@?@lp bH@ * @˔ ? " ,L :, ,Op p@@x / 2` -/@'l l@ ~ ''"xb@O @w}#b!''!!@wqb!@ @! 2C"? @e  ?D1"!0)8+1'?h@e ?@? # Րc0#h   ʐP@` ?0 ې?C!0 h   #x@2 @!F #1#C "!,1 sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@z 1?'' 'ؠؐ @ɔ  @Ŕ "#'#'C!, 2 #'' @ !!@v#Ȓ!@  '8#a/? @e"  ?@ `1)#%?@e ?@?    aG1Ԑ    @a@ ?ڐ?Ԑ    C!0!d@2Ԑ?'@MW0Ԁ   ha˔1ԑ:  21C"!, `@ʔ1 #āsession database close: %ssession database open: %s㿘#Ā "  @ 8@##`   @-ր "c  8@## insert %d: %s㿈'D ' 'D?#   D8@v# @m delete %d: %s㿐 ' '#   8@[# R 㿀'DD' '#     / *` *` *` 㿘@ 2  @Q* @Ma$    # @Ma. $  㿘@`   " @Z@X   @R@P @N%s%s/dev/㿘 & ,  (@ , @ , & &@@ & b@@&    & ("#& $$ (& $%s %scan't parse getty for port %scan't parse window for port %s㿘  @@ @Z`@W@@Ő & ch`@S@f   & #p @ &  ` "   @@~`L&   & #g @ &   㿘 #  " ( (L "# 1#@;   `U 20@<1"can't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@xq? !h 0 '@c @JA 6 ! @te@ !@ @ can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@ ` `? @KP?x?@x? "`l? h@e@)  @\[?@XO 1`  R$`  O$` ")`@J` @!?8#   2 b@ @2@ b@ܔ @*@(@ ` $ 4 `"Z`@ِ ` "'A@ѐ ' @ `@s@`"@2`@א 㿘# 7 2   @ Ӑ$   $`" ("`( ("c (` $"`$0L?2$ C#"a0@ $  C  C 0 C 0 0 0Cd 0㿘C&"!0 V # #C#  2 ( ?2&  $a0@ & N ( 2 C!0 C1C? @a ?"!0v!0 ?C!0port %s changed utmp index from %d to %d㿘 #   ?&  ( 2  @9V @ # @   ( 2  (  & # k& "    ?&  #pW   &  @ 0’f0@:# "1 2 ( &  @Ւ  ( 2 1"   (2 "ք   shutdownsome processes would not die; ps axl advised㿘#` `  "` `(`2`  a@Ƞ !#81%֓, ?@ ?2$c ""#$@G( ? @` ?"Ȁ c ?c " #Ġ  ݓ, ʐ!1#ā㿘@q_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘d"@cp@ a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@/!P+#8)ߠ '%ސ@?5? .* c%`p% t$$@cC"ah@cC"alxɐT#& nT#* @"ߐ "d "`| p *ސ ' ' ' ޔ @ ? @r`  ސ#`@s    ("`p#Ԁ ސ 0@c @@`d P@`| `@`p p@.`( " t p@$`   p@`x  ߐ "`t@C` d@袒 !@{  | @ ސ `@q |#@ @g @5#؀ 3"@!ߐ @BՒ` | @  `@q | "@  b@q`@Fl@耢  @q`@ nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8C@2-a8 !HCa8  !ha8C!8 ` !h ` C!8 ` !h`@$ 0Đ@0  @% @ !@0wȢD  @ 4, D, 4` @< 2* @ *  @~  !@0V@̖: Ȁ̀!@0C@,  t  `  ! ! >@?@`?# @@! ?@@ ?# @  ?Q`@ 2K`@?@ `?# @! 2 @9@@ ! 3@? ?c @ ̀@2 @%@@@@ ̀@@? ?c @! @"  @@@@! @# #?B @?@ ?# @! 2 @6 @@ ! 0 @? ?c @ ̀@2 @" @@@@ ̀@ @? ?c @! @   @@@@@! @ @?@ ?# @!" @ `@!2`@? `?c @! @ ?+" @@@@! @? " @? ?c @! @  @@@@! @##? "@? ?c @! @ "@@@@! @""Ca8` "l` "h`  "!  h!#܀ "@@@6  h"`x#Ԁ "0@.` t "`"h"H@!"x@C"`x@@@!&  & &@ t `  %s: devread: lseek%s: devread: read㿘. >@   "bx@o@U b@ostatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@  `@n@ג C c(@n!h J#ܐ""@hC!l!h"  * "h`xސ c8@?#Ԁ  h#P@W  h-C+)'%h* `l, "@#Ԁ h@? hh#Ԁ @2#p0Ԑcx@   c@   c@?u@  c@n=@  a@n4@!֒#Д ##@ 0  @?Nc@  @   ,@  @ @@i @  x `* @ d,@  0#@Y x* # 0"@ 0?: `@ B  @;   xߐ c8@? h"#Ԁ #@ `(`(53/ d*@l,"@cԀ h@   뀤#Ԁ @#pC#Ԁ  @`X 0 0 t" /-+ d*@l,"@Ԁ ch@^  t ꀤ#Ԁ @L#p c8@> 㿘@2more-E-m-GMORELESS--help-?--version-VVISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t option㿘@X@"``( 8@ja C "a@g@ @1@ @.C!  @*r!@*o!@*l!!!@@*c 2*?@@>a؀ 2@@*V!@@4a耢 2?!J - +@J  2@@,A  @`@*8? 4@@,5 "@,F@ې @t"瀢`" (J@ 2@h"瀢`" (J@ 2""`(@X"倢`"#J@ 2?"("c?  @@`?@  怢 "c@o  @  @0@  @@  @ @'h@ @8@7 D @ ,@H $ D"8@/ @n D@8 @ L 2@d @n L @\ @8倢?"cX@T c"#\@ @ @d @? @@(@9 㿘@W.㿘@ @  @Cannot allocate memory㿘@Ò "@/V @ JJ "  " 㿘  "  "`@ # C!| @@@.@  @/dev/ttyhC!!C!? #@  $! $! C!@ ?ߒ""`"`"` "`"`"`"`"` "`$"`(@bX"j8#`n"Y8`2"P8`Ixۀ`KIsۀ`"L8`Ejۀ`Ea,Fc !@"O8g"C8d<Tۀi`<"@;K%"@"<8#@3>8!@1p"@038.2 + 8( & 8# ! 8 8  8  8 8   8   8 8 2` "`0"c"`TԐ >'̐  ?''̐ //ߒ  '`'`'` '`'`'`'`'` '`$'`('C! @A`Ȁ?C"!WARNING: terminal cannot %s㿐#  C! '#@.LINESliCOLUMNSco㿐!C!? C#@  $! $!C!`h@   `" @F "@@R ("`` C "`C!`h@  `"#@" 0 "@@. 8"cc  P"ckrklkukdkPkNkh@7kDh '!@̦!ߠ"D@Ӓ@Ő` ,` ,`@ƒ`@ ,'!@̦ !ߠ"D@@ , ,@@ ,'!@ܒ̦ !ߠ"D@@ ,!ߠ @ @v , '!@鼒̦ !ߠ"D@q@b ,!ߠ @e @V , '!@霒̦  !ߠ @Q @B , '!@鈒̦  !ߠ @= @. , '!@ț  !ߠ"D@)@ ,'!@`̦  !ߠ"D@@ ,'!@L̦ 2ߐ //Ҧߢ"D@@ ,@ ,@@@ ,@/ 3//ҠА@ߒ@А ,@ T T  `//ѐ@͒@,@ߐ @Jߐ"D@^TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@c" "@ΐ 4 ""? /@r"@,@k""` @f""`$@a""`8@\""c@K"倢 "cd"cd#d"" <""#"4"#h`""#ߐ#'"@A"#8 *aX"@5ဢ "`""`"@*ဢ "` ""` C! 2"@"`$"@"`(`$ 2""`$`( ""`(#@ "#쀢`J@ 2 G#""c# @"##Ā  `J@  +#(""c#@@˒ "#耢`J@ 2 #H#X"c#`@紒 "#䀢`"J@  b"#"#ؐ "c#h@盒"#`""c#p@狒"#`""c#x@{"#`c"##@kဤ" `c" #@[ဤ" `2 #"`##@Hဤ" `""`#@8ဤ" `2 #"` ##@%ဤ" `""`#@ဤ" `2""`@# #@ဢ`" J@ #"`#@􀤠`"#J "# @ @@  '@t"c#@’􀤠`"#J 2" c @@d@U  '@F"c @攒􀤠`" @戒􀤠 " 8  "#ܐ(@"c#J "#, ,㿘!$ ,`@ ,㿘N  N@ 2N "N@  ݐ6㿘    $`/@C "a㿘   !C!   (`/@ؔ$!㿘#ؒ /@Δ㿘#`/@Ĕ㿘# /@㻔㿘# @( /@㯔㿘#耢 @@( 㿘 J  `/@㕔㿘#`/@㋔㿘# /@ゔ㿘#Ā ## /@p㿘# /@g㿘# /@^㿘# /@U㿘  /@L㿘  /@C㿘  /@:㿘  /@1㿘  /@(㿘#` !/@"@(_ ` @"㿘  /@Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@) ?@  "=!P;!h!@L ?.!@_ #X! # ?@ ?@!@([ seek errorread errorWaiting for data㿘 0  0`  2 `  @2 0 02  0 @`?#  0    P 0   @ "# 0  & &  0 *  @ ?@6? 0`@!C`  ? 0<`   @  ? ဢ  0#@'ߒ k? 0" C!?2   0 $  @&P"   C *` ?"?〤  C#(@' r C!  $ ` @  0`"`  & "`$#  #8@'ؒ @   , 2? 0 "` "@&& " " 0  @n ch_ungetchar overrun㿘? C!?"@'^ C"!Finishing logfile㿘C! !Ca !C 0 $? "a#@' !@? , !C@ b!?$!C"!Warning: log file is incomplete㿘  0 c@g:  ')002 #@'    C!@   00 02  2 㿘@ ?4=  #: #`0` '`#Ԑ `0 "  0 6 #!@q?`,  0    0"  # <&"`  㿘1 0` @`  0"`$@:? @B?  ,  㿘  0 2  0  0@&  2 0"`"`  􀠠?0$0* 㿘 0@   @  ?? 0` #4 "`  0` "`"` 㿘 0` ? 0    0` 2 `? ? 0`?"`#"`  0@   @  Cannot allocate %d buffers㿐 0 !# @N  0 &'`@%Ғ 0      0 seek error to 0㿘 0` ?$"`$ 0@?0"`@@2"`! 0@  0"`$"`"`"` `   @ J ? !x@% 㿘 @$  0` "`?""`"`""`  㿘 0@ ! 0 " @2" 0@  0 0" 㿘  @  ?  㿘!C@!t  $ 0 @㨒 ($ 0" "?" " " " " " " " $" ِ C 0` "`C!t@`0 0` ?""` d㿘 0     0` 2   @ 5`  0?"`  !@ 0$ 0C!t@ 08bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘  @:+ !@' *`:  9   06,` . aP0 b caP0     * ?N? @$ M *,`@$ E ,`  N !@!@, *,invalid charset name㿘 "" N C   !!  @E   2 "@$K  㿘  @7c` e @  @J  * @  "* * ``*s<%X>  J* J*"CJ kCsd C  uC ܄  ܄  C  C  ܐ C LESSBINFMTLESSCHARSETLESSCHARDEF㿘 @=  @8 t  @1 Ȓ  J@  0 @  @ %cESC^%c㿘    8 a  8 @ޒa1C @ܐ C 8 a 8aؔ@1 8@"!(@  㿘@!@㿘!!@@#R a$a!!J@!"@$!a,@`L@ 2 `! !?! ! @ *`: @"@v`L@  @! C!d?!C"   !@@J@   㿘!!J `! $!@"!@A! $! 㿘!!@@J 1!@!J? x!J?a@! 1!@!J? c!8J? 㿘!J  1!J 0!J 1!J  !J ! 㿘a@! #!!@a$aJ@԰!"@$!N  !a 㿘J!@ "  !A*C" `?㿘!!J ! $!@" !@! $! 㿘!!@@a"aJ@!!"@$!N   C 㿘C" ذ 0; C" ` " `"`C"    #Xa@"! #%a*a`J@H $@! a $aN !* 㿘!C" .@-!@ )"  #C% @ޒ@ b 2 #Cb 2C  l!@$ b $`$ `""`C" "`㿘C" @? C" C!䀢@"@ Ē `!*` ;;9:::;<;\;p;<<8<8"bH#bH@#a $bH  @  @  ` ` @  @ Y :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈 "bH  2  : "/%-  )"HC%D$L*"P,  @$. ?, , D "/  D "/\  '/'@7쀢 ` `k`c ȓ*` S,RT U|RXXZVXTLS RSU`TTYxVtWdTZ|WUXTpYXU(SLSpUHVRtRZdZdYX8VlZZZUUUVXlZZSTZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZOd b  \,L`"#L @m$LL @  0*L`"#L @Z$LL @  0L $$L;LL $$L>LL $$LL+ L $$LL- @ "#"#|,  !  @ r  ,  "#L 4%cc @ a 0L 4%cc @  0 J@@ L $$LxXL &$LL d d$Lm@ L0hL @ t@ L0]L &$LL@ ,c0R@'"J 낐 %"HL $$LdP %"HL $$L\0"H %"HL $$LS, L0d"H  ? "H ? &"H  ? "H ? &"H %"HL $$L/ L@%"H@   >@" @ R 0,C b(0?C@ !t@Rb8 2CY"@#Ԁ R"`#@Ӓ @C@0!t  0L $$L@)L # #| L L $"#'"L $$L@L L "#'"@0L $$L@L "@ 0 /b8 ""T b}  0#c@ 0 bg 0C b`0 bZ  0#  @0| bB ~ 0p#l j h@0d %b* f 0X#T   .@ J*"XC %b 0[c 0UD R c 0H#p ("#x㿘C"0@)!LC#@= C@M㿘  @׸  @"`"`"@& ?Warning: some commands disabled㿘C#Ēߔ #h@1 Warning: some edit commands disabled㿘C#Ȓǔ #@ @ 4J@K)` @ g `"$ ?""2J@ 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2㿘C#Ē㿘C#ȒH"H("@㿘@J J ?i 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0Đ@ P@'@9?  㿘@N @ @d@ֺ    @ ?  @@r%?@5@j"L@@? L` M L` +L` Gr.lessCannot use lesskey file "%s"㿐@&    ' @@ːx 0D # >  $,@,@ ,@ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?L@ ?0 㿘\@& @ & N@ ".@` @*N@㿘`@Đ@ @*N@  N@ "` @ `@ J"?8J?  ?J?㿐#Cat @?at@@1!C#Ԁ  C@!t#@`@ #$#C"!t㿘 C@at0 @-%s"%s" may be a binary file. See it anyway? 㿈C!t" C!t   " @'@  K @cȀ C#'A@ '#@@쀤`@@@,n @ '@'#  @  @k '#@쀢 y Y @π` !CC"!x$!tC"#"b`@f!t@]cX "cOC!`# C@ C!p !C!|@`? $!|# " @?@ ,@W  # '#@l 㿈C!t 'CŒ `@   耤`@t@ !C @!t!t     㿘C"!t@  㿘C"!t@ 㿘C!t@x? " ` 㿘C!t@r? " ` 㿘 @S "  @ɐMissing filename ("less -\?" for help)㿘C@#Ѐ "  @̒ 慐 #ȁ㿘{?@B@$Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@z @ C! "' O!@?`0T"*` kkklkkkkkkkkkkkpkkkkkkkkkkkkkkkkkkkklkkkkkkkkkkkpkkؐ@&!C"a@' !C$!  @ ?C!@[!?$! ! C! '"@%s/%s㿘 % L@ !@=@: @j   ` @1@ @ @HOME㿘@< В  LESSHELP/usr/share/misc/more.help㿘@%! !V㿘  @#'C%C*`:  # %2 t 0 x 95@V`@`L@  ;  @ 1C'C*`:  # %2 @!tx@5`@@, `L@  @,%s*㿘@   b@@@P @) @&X    @ ?   @8 @  p @   㿘  @ܖ ? ? 㿘 d佒 ? $@>  $` $@&,,,䠒 @:@Ɛ@),۠ ,SHELL%s -c "%s"r㿘@`@" @  w @@% N "@@ _ `Ȕ@@@ ɒ`ذ@zecho %s㿘!В {@)N @^0@[LESSOPEN-㿐 ?@֐"P @fb` "/ L |    `T @Y  @  O&&@"` 0@ ސN@  LESSCLOSE㿘"@ @#h N@ 8@ @ِ,# ( <  @I 㵒 @OCc<   @7 㣒 @=Cc@T8@k 㿘#耢 y㿘#  , @L??sc| "c|㿘c @"c...skipping... 㿘  ?4     ?   2C?7쀢  ?4@쀢 D 2 0@@?@@ "?@3 @#쀢   ?D 2?@!?,@)D7'倧 ?" 0@  @ ?)@Ր  ` 쀢  D @  D H   $쀢 @?ɀ # "#|  , c| "c|)` D"D@D" @-?㿘/ @4   ? 将? "#|@@` ?F@? `ڞ@@?㿘# #|    ;c 07@ ??-`   @ ## @  @   @?? c| "c| 㿘@ ? `@ސ? wi䀢  쀠 #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘O #`@ 0@G#@C` ᮒ cx`@>@ѐ@m #@ @ǐD D @" 2 㿘`2@D @&& @" &@` &  D`( "`(㿘 "` "@ђ?D`(?"`(㿘 ^ I& ?& & ˒㿘 !C!t@%$!tԐ@n @l 2DD"  2 D D" 㿘 2  D(㿘D   "  @U   㿘  "   @" `"  "@ "` "   " 㿘?c# D 0* @@L C T@@*:?H  ! !# , < ??@1 ct  ?  ? ٰ@#l !   ? , @+?0{㿘 d#  D 0* @  $ @ؒϐ R#l &#ca醠  ##|  ?`, 02#0/> A`, &b ?2`,,蓐  0+ @j@w臐)+ ? ,  @?0` ?@  ct 2  @P ,0ۀ@@HCannot seek to end of file㿘  #p@3 0j    @Cannot seek to beginning of fileCannot seek to line number %d㿐@? "  @yc04'} 2 '@lc # ! @㿐@@@YDetermining length of fileDon't know length of file㿘s?!!@ &i?!!(@ 0 @!@ꀒ d6?@ć㿘Ő  ? SJ@Cannot seek to that file position㿘@Ґ@~ $ $ @?D@ g猐 !"8@i 0_@ @ސ?2 ? @|"#|"#"#P ?  &@01 "?  ~ 0' " ?#? ` ?@J"#P@Ð ?   h l t x p(|%6d㿘 @ D@I#!#bh"@`bh@bl"bl @ 6 "hh+ `@ "h`  "` #! "h#1"h-"h, $"hbl $bl@g "hbl""p      0   0  4d      0   0  <h㿘 %?鯰  "h`  "hJ ``"h`"hJ 㿘"h""h!#bhJ J@ "l"@$"l㿘@- 2 #Ȁ bl@ @#@4N "h#!G "h``#J "hN  [ "h? ."h`"hJ   2倦`2 Z  bl?"bl#h* "hh* bl@"bl 㿘J"|  @b  *"|   H *"|"" @㿘bt ."btc"h. : J@  _  c  #bhJ  #bhJ _ Ð D   H "     0r1o Β "h h  b"bt` ! "` %#   K"h $"hl@`  G 聐 5#Ȁ  肐C!!@`"l c 4%   !*`: ߔ "h $"h N   ϔ  bh "bh 㿘J"|  … J"|?b"lc   $ #Ȁ ch *@ "hh* h "h#h* "hh* ~ x "@$p$x HhH"@  x㿘?)? $P?##߀` ; ,; 0?`,#&@㿘 $!?䋐? ?0 !#,#B  ??, `2&@ `            " 㿘""    A 2  @"""""@"`"`"`$ $@ʐ ȐƐ" ""  " 4#" 2 " " "@Calculating line numbers㿘%!8@  D "`8㿘!"   d$"@ _$"b` ?$"㿘 @ li`q ""     ` @ @ 1"b""    $@  "@)   G ""  D%ƒ , 27 ?"4  D" 864'?0%k  ! ""  D%Β , 2 ?  w?D" 8㿘`Z ""     I @ z""    $@  "@   24? - %U , 2'??   2?  %i , 2 ????㿘@ Bm? ?% ? @ 2? ?""?! /dev/ttySHELL%s -c "%s"sh㿘N -  T&@ )!@ '&@ $!C!tg @] @N @( @ &!@_  @ &@"@ L@ N@@  &b@  N 2&"@̇@@g @@c@  z "cP  ߐ @ 㿘@?@  ?" @ ? .@ @Cannot seek to start positionwCannot create pipe㿘 '  '@` ' @ؒ r?ߙ&@n!@l&@i!'?@1٦ @  @| !v?C  ?` $  @ . :  " * $ @?)޲`# #N? ?` $  @ . :  " * $ @Y? ߀?@ @, @B M ޷  "cP@'  ?(( 3 ? Invalid mark letter㿘? . * 1"? '#0@=  . * 1 аCannot seek to end of fileMark not set㿘 '", . $0' ^$C"& & at*""r ' #!Ṱ"&  ?& !ᰰ"& & C!t$"!   ?'#@  㿘`?㿐  @ & & C!t&㿐@ ? "`"`C!t"㿐 !@ `?2 'C!t""`#"``'`'C@!t@ Mark not in current file㿘h  C!t@(" @ ?Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &C  C0.0+*"!b ("  C! (" C"a<! C(" !'("В@0㿘C "a’Line number is required after -l㿐 ' l@` 2(`D(#@ 0 "`HCannot use lesskey file "%s"㿐   )' x@㿘  0"D " @׎@: L`C!t @? ﮐ ׀ 0<ćTags file "%s"㿐 E  """X0]E"bX"X')!@/㿘  D " H馐)飐"%s㿐 )  "N@0,+N@ M" m = # # `#`E"D`#@5 &c D* @')"8@[㿘   !k P$ P㿘   @ 㿘     Use "h" for help㿘     )#@ 0  @>`C "a|ɐ ܀4There is no %s flag ("less -\?" for help)㿐 'D!!(    € $!("!(DJ*!0 J? `0Z'D*` ppppppppppDJ@ +`?`"iJ@`d'DD " HDJ@ +`'DC"apDD@P'DD?'D z@ 2  @b'* x@s,    "`   `, # D&     `?"N  @  @)`? J aD@o'DD@  "@ D €DJ@ U There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@c @'*# ` @@א'* # `! @̐'+ @ݒ0    HJ "  ` @  "i``  "#   ]`: 1W`"M` "` N`"` J`@``?B"@"9` "` :`"N@6`N@@@` @b`?` )"@4(`$+ "` H`+` @ 2 ``  "`"@ P@] 05`   `€H`  @ '`  "`    ` * @ '`@1`  "cP`"  @ ` -%s㿘]1! ,@{F`! 㿘@n "   S@ 㿘@b  ` 2`(@ String is required after %s㿐ϐ', @㿘!(J㿘N 2ԉ   `$2 . N Number is required after %s㿐bL -   ?А ? $&',!@R   ?А* *`:` ?Р  А (. $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe less helpful in promptsBe helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenDPHP  "    J2 DPHP_J "  J( P J 㿘'D'H'L@Ɛ!0 @! $#`DH@bL$#` ?"#`@S ?㿘!0@ 㿐@%s: %s㿘8@#@y@v  .c8@xq * 8"㿘!E E@ d$ E  . * * @ d@㿐 ,  m"cP C O>    0    ׿       ׵  ח  `@9   0  0 דף׳{㿘E !X@C!|   aX@g "cPE!X"`㿘E !X@ c "E1"cE`* "`㿘*` : N 㿈6 `2 @ 0, @ ` -, 耤 $?L?㿘 ,*`:  % `N d  s2N@` *` : `L  N@` @N ؒ㿘 c "cC!| ֺ#dC!| Ek 0%  #@  q В   ?M# "cP*㿘ց֑EQ ֒ "c㿘C!| hn@C!|  0 #  "cP??? EE 2 8E*  @ E*` `@  E( ` E*` `"E   E? ("@㿐 aX!E ?@S@ #E'#E! ϶ $` "aX`*  "?E ?6?E* @&? * ?㿘  @ 4 E*   *   ?E( "   (?"  $ 6?㿘E0!c"cE*!8$ E&!$ E"!E"bD\H "\""\H"\%ld㿘"\1b@u%d㿘"\1b@u㿘Z"\ " \ ?( \㿘ː !      -㿘?. > `61#*` ɠ(D`lɠɸ"\!` @@ 2: 9#|C!t1@ɒc0@ - @  @'0X 4!  0# p?d4  0]:  @ C!t@  㿘?`62"*` hhhhhhhhHhhhhhhhhhhhhhhhhhhhhhhhh hhhh,˄hh˔hhhhh8?\0; (0XCP!tC !t< Jݞ ` A <ϐ?0:ʞް?.`+!|a`"\ !`\J  "\\Cr!t   J:" ?." \ J2 02 0?㿘N l"   p b" 0UT ?* : `2J3!X*` Dddddddddddddddddddddddddddddddd8dddddddPdd,dddddd$&@?&@? &@? &@#&@&@?㿐a`""\N 213Y"x ?#*`:  :# ? %" .-b\ \" b\*@`!$b\ N p 2 G N ?\ N "#"\!`@ 1"\` *!`@"\&1!`㿘E"D 㿘# D*#d"@#"@  @' e`   (8`b(" @J@2 @( @*`J@ @* e(8   J ET@ 㿘倦 b``. "b`#؀  # ?%?"  @  " [ ?""`No previous regular expression㿘 4"pq 0b``?"b` Invalid pattern㿘  @  E@"4"R  ?"T "E@E""T 㿘E"T "E@E""T㿈E"T @ `? &@& 㿘E"H "E@ E""H?"bh"dE`2 EH"  "  @$ 2 㿘 ``  @ 2" ` & &` " ` ` 4 &```@&@܋0&@"㿐  +   &     2J@&  J@ `'J` `J` ݐ`'J` `׀ 㿈'L='P:'LP   L""`P""`P(N  L%P L H 耢` 1E@'a"H耢`2@㿘"p c""l㿐f? ?@Lo 㿘""`# 㿘.  $ ӵ?kӮ#   ?u B#n M 㿈A+) , s?` 2`  `X`?瀧`2'@T @  , $bl  H  bl@  H "e@ 2 @   瀎#  W 쀧 2' Nothing to search㿐`N@  24Q"p#  #  b` "b`3""`i# 4 А M?  ""p# ""lc""l# _ ""`# ? '`&6" !??  #  6 0 cc#  *  㿘'H3bd"h pbdH?  "h?HHD 0*` 'H9HH??"hH D 0*` 'H"d'H"dD 0*` D  0*` &"h&D 0@ D"h`0"H?H   H H?H""d""h㿘 7@b`, "`,#` 㿘 7@ c0`, "`,#` 㿘 7@cx`, "`,#` 㿘   7@b 7@ߒc0 7 cx@ْ  @֒   @Line numbers turned off㿘 ,U"" , @ۿ Ǧ]gܐ  @۴  @۱ @@  7@۩c0̐ 6 "cP!#) #    2  : " "cPaD`8 "`8 @  "cP" @8 ( tagsrNo tags fileNo such tag in tags file㿐E"X8@1a 8}!@ɐ"x)+' @ ܔ j@ܓ L@  %c@% L$D)'J@ % L J  J@  `'J`   *  ''J ǐ $D )$DJ@`'J@ ^`'%c@ J``\2 ' * 'J  J $"*@0 @8! " LTag not found㿐#D   ,9  &?Z-+), U`@ ˒#@@@ ,/dev/tty㿘9!@’ 倢 "cH "cH㿐#?cHK ? ?Ow O "/ cH㿘@ Ffs.%s8@t)9' %#@`!؀? f"$d s F"$\0"$`X@T#*`@&  ` X A"B!P "@  . " @. @@9a@4 @`@/ @ۻ?@<  9a@2<    @@@ `@@ۚ%s: is a directory%s/%s8 X @  9!K \ <  9#@Y= @ <  @2 /  $9@& d  @ 8#  9 `€ 9!@Y 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘d":@1a0@ 㿘@㿘 @@`@㿘`@@ @㿘`< < ` 4 `< < ` &?`< $`$$`<   $`$ؒ?㿘`< < ` 4?`< < ` & `< $`$$`< ? $`$ 㿘`< < `4 `< < `&?`< `$`<   `?㿘`< < `4?`< < `& `< `$`< ? `u 㿘`< < (`(4 `< < (`(&?`< ,`,$`<   ,`,L?㿘`< < (`(4?`< < (`(& `< ,`,$`< ? ,`,/ 㿘`< <00@4 2  <44@( < `<00@4? 44@?㿘`< <00@4?2  <44@( <?`<00@4  44@ uappnd,uchgnodumpopaquesappndarchschg㿘* h   h;@iɒbX;"`  `@i h h;@ibh;"`  `@i h h;@ibp;"`  `@i h h;@ibx;"` `@i h h;@ib;"`@ `@i h h;@ib;"` `@iw h h;@irb;"``瀦` h ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐 @2&@2&')@'%<@3`H "$ &L "< n2 L  o2    ?* : `<!\*` xx@xxxxxxxxxxxxxx@;b@Δ  <```P@” 2 `"<&`"<@&@`?<``@  2ǰ `"< &`"<@ &@;bx@  2 `"< }&`"{<@ v&@;b@x  2``<`h@l  2`"^<Y&`"W<@R&@;b@U  ``<`p@I  <`x@B 2a `"4</&`"-<@(&@;bX@*  2``<`@  2`"<  &`" <@ &@;bh@  ``<`@  <`@ 2 `"< &`"<@ &@ COLUMNS1ACFLRSTWacdfgiklnoqrstu㿈@ @f =@!" @zF"`0`h@֫ `F" 0 "aL" "a,@   "a=") '%31/-+F=@:??π D* @d@LX`(p4%!,$H$$%!,$H$H&a$H&a%!,$&!%@%@&!"! `% ` "!"!% "!8"!$$"a0~ {"!4x"!Lu"!s%`4p"!m"!P j%`4g"!<@d=T#&* !$ !H !  ! F 4 "`!H  ! ! "`!< 2`!H ! @ga0!0!0 &!: "@! )F 4   :F C!,>!;;!!@ :3#! ";+ :("t 4   : !,!;!0!@ : #! ; :!"`!, A  H!H A!<B "` F`<@@} %s: directory causes a cycle%s: %s %s: %s: fts_read㿘!8  @#d@K 2 @- @ @p ! b!  `  5@ L8`4 " ?  "V`20 !?0 @T`@0!?`@@xI` 0@T0  N`@ .!  ? 8@y7`  ? @@y/` &@-@!  @ 0#  ?@->`H%u-%lu%qu'D @:'H't!$  !H2't!"''t' ''''|'x  HϮ'p'l4   D!?@@w 0@T+ `2 L@4`! $ . !  $ !L @ @M&&8t` <`8 2``< (``<` 8'`  8'`08 `02`<`4(`<`0`<!H f!  p?bH@&` l ?bH@ `p l` @闒 `@Ē @x 4'x@ | 4'|!4 ?`DUbP@@ 4'    @`    @,f $@d $ @d`< @@@ '!4  $ @dג$2:4JH'''t`.''̠ #?bX@@԰''|' bX@@Ԥ' bX@@Ԝ' ?@`@Ԓ'x' @ "`!H  H@㿘 4"2 @ 4 +   2$  2!?}@R 2 ! 2 瀢  ? €@㿘 #d  @  b@? "b@* $b@ @eϒ   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 "!H 2 ! "  ?a0@ސ A@w; -A+<)d !$ <A  @w'`!  !0?: `8@ B  @ϕ;  @w`@A $`  , #\ #` @w!4 A! @v ` @@2  A! `@v `瀢    (A! "@ A0@v`0 (@v`0!@ `! "` `(@A!8@vƒ@! "`@`` (  @% "@? ""@* %"@ @e 2s 㿘F @$"! @*` $ @Q  @  ` .`"```2` !$   !  ! 2  F-  0 !FА0p 0@ɣ 0@ɟ@ɛ@{ 2R 2  !H 2! @?a0@א A@v4 Ъ @B97d * ,@ @9   d"@`?`$``@ @* $@@dc   @? "@* &@ @dL `@Ħ 㿘 !$`<A @u ! !0?:  8@ B  @;  A @u˒A!8@uƒ`@! @ 㿘'D@_D d"@L@ ?`&  @  * & @c  $L@!P  d"@L@ ?`&  @  * & @cؒ  $L@VdD;!@s:  d"@L@ ?`&  @  * & @c  $L@1dd"@?`"@  * "@c  d"@L@ ?`&  @  * & @c  $L@d"@?`"@  * "@cl 㿘<(@/d @@ I0N0@/8@: I0Fd"@?`"@N /G /d"@?`"@@ |9 |"@?`"@3 @, @d"@?`"@% = =d"@?`"@ % %d"@?`"@ * ** "@b   %s/%s ls: %s: %s -> %s㷈V 2 2  $A8@7 @ $D @. @@$? 8@sp#d"D`(@\0*@D@ti 8eJ   H ? (usage: ls [-1ACFLRSTWacdfikloqrstu] [file ...] 㿘d"D@,aP@ 㿘@m:pinvalid file mode: %s%s㿘@r  D@בa@  : ! 'D#8)D@UЀ? m p @-c !ؐ @Zc@⼒!@T#* @@  @@-, -`@@(T ? / *@@@8J@ 4 @@ 4` 6`  @@>4  6`D!@O+@ `@ @Й/%s: %s8D#%8@c@L`?,@  2D`2.`.2 @  D!@N?<    /!D@r} #@N֒? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘d"E@Q`@; 㿘@&node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐@ "`@_`J c! !`J b E@ra8` @- ` @ J@  E@aaX`@ `@ J@  E@Pax,  2    E@Ba. `@2`  Ea@' `@Ϸ usage: mknod name [b | c] major minor 㿘d"E@c(@Ϣ 㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿈@o F F"p5 #8/F@S?k? 8d* TX`ht  &dcJ@ "F@ F"̀ F @ `@4cc@%` ?@FT#&* @ ^  0F06@X LF @`耢 F @` F @` @  F @Вa @ ۀ   `?#\@. 2Ϣ 0@    F@%a. @@ < " @6@ &. @F"̀ @@@@o@ ' Fa@@@ L 2&  Fa@@y@) L@@ 2  @@ 2  Fa`@g@F@u`耢 F @o`  F @i` "  Fa@P@ #\  "̀ 2#\@F@o{a F!@@ђ 2#\@` @@`%@  F!F@pҒaࠒ Fa@H  @8 ? 8#  F@$֒a@@͂,㿘N@ n N` o `@] 'G`? @ J@ n J` o  `@oӒ "  @o̒ " @ɺ/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %s@ђh `H hH  O@ F H @]@ڒH@|a \@( %@"h Ԣ@̈ Z @̀  !` ȒH! H@oa0 H@a@F@`@H@aHh$HP@w'dh$d 'dd@d* $  'd* $  'd* $!d H!`@o dH1Hh, !p@o@  d, H@o!xo @&?  F0-H@J!@А_ #h9H783H$!@*@"Вh  a@J֔  8# H!h@JȔ@< @ȧ`@J `H@J!,  `>  0#   " @ H!@J0!`  @Ph H!@J @h %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘I!  L @o   F "I"'I%I    2 ``@n ,  ```II""?I"8H I" @nҖ`I"@H!x@n㿐@ꁒ  6 , @ @!  @ L@ 2 , ,  㿘F"̀  F !X`?"@    !X@ empty type list㿘  N  n J@̒` N  o  "aX"!X  @v , ``!F`@x* $"̠ 2$ @"}   @v , ,`*@`$`$%s,%s㿘 L@ @@ @M  @"S J@ј`@[`@`-o㿐@''G%FJ"8@% "$&@N " -, & @v; = .,  &  @Y , & , &ڠ usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘d"JcJ8JhJ#xJ@c@ ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 F@a  F@la 2( @h "" @  K @Ւ` KF@Β` KK @H   H @H  ,-o %s: option not supported㿘@Z=  @!j K@aH 5L n L  o  @ul = 2*@lw "   "K @2    &*@& aP@`Ƞ @K㿘@`////////x/p/h/`/X /Pupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaego:Rcd9660%s: Filesystem not supported by kernel%s on %s @ ')KL l%8#K@Ԕ#Ѐ?I? 0B* 1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1X1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`1`101`181`1`1`1`1`1`1`1@   b@] @DT#&*  @@9@`'?'  ' '''K#ؒ@ 8# - Kc@wL`@ D@ usage: mount_cd9660 [-egrt] [-o options] special node 㿘d"L@b8@ڐ ,-o %s: option not supported㿘@X  @  L@]b 5L n L  o  @t = 2*@k# "   "L @2    &*@& b@ Ƞ @㿘@5P5@58505(5555444 4@444reloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @s%M'T8 "`"#8!L@[`? ? oc#@h@PT#&*  @@E@'`?'  ''M!h@  8# " M - " M 8"M8 !p!!@i# Ma@%@ǥ usage: mount_ffs [-o options] special node 㿘d"M@cp@Ǐ ,-o %s: option not supported㿘@W  @ʒ M@cȠ 5L n L  o  @r̒ = 2*@i "   "M @2    &*@& c@Ƞ @ë㿘@;;;;;;x;p;h;`;X ;P;H;@;8;(; ; ;@;::::: :@nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernelnqnfs 1/mount_nfs:nfssvc err %m@)G #"b0'x'tGb@ X'G #8+G-GN@k?ǒ?΀`FO"*` ?T?4DDDDDDDDDDDDDDDD?DDDD@\DD@DDD=DCDCDDDDDDDDDDDD???@LDDDD@DDADDA(DBClCCDDD@D" "$N @'c "%"N @c  =$ c|@l |J 2O`6$ 8O `@ c Sb ~%b  z$ c|@l |J  `4$ @ O` @c 6 (a$ c|@l| |J  `4$ ( O`8@c   @H$ c|@lc |J  `4$ < O`P@c  @ .$ cNa(x@tt b %bt    $ t t ($ t t  @$ t  " "$ O@톒`ht@  "%" O@z`h  =$ t @@  $ t G""t$ " "$ O@`` !$ t(t  $ t@G$  "bt@cO@S`@g 5't" "$ O@9` !$ c|@k̔ |J  ` O`@#c""0c|@k |J  `4$ $ O`@c  $   $ $ G ~"bc|@k |J  `4$ , O`@c  h$ c|@k |J  `4$  O`@c  R$ c|@km |J  `4$ 0 Oa@c  <$ G9""@z6NT#&*  @@o@`@ O@) !(x@ܖ  8# - Oa0@엔@g %6G"耊 O@}  ? O@TaX@ @P@ΐ @̐ @ʐ O@g!`O!h @D% !'%8#O@   Q @Cax!@ݐ no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRC%sMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!!Ȓ@o Z!, Z@n @  @n : Q@B".  *#@c al `$al @  2GQ "@> Q"@A  !l@@H G"     ""0  ` =&` "0 "ax"0 7h%G ax+ -  o5 G" ,Gab@o, 2 5 耊 2b0Q@Y#{b0 ''G" `  abܘ @U\  ''hab@oܠ  耊 2Tb0Q@Ye# Ob0@\$ ''`$  %%'' #\@ SS  # 耥G" rQ@Wc8d"Q@֒c0耊 2b0Q@Wc@Q@A4#0 b0 `@  @%b0b0? "%b0耊  ?@$耢  ?Q @cP@• @@a @_ @] O@!` $@C <b0 D !x G"耊 8@v !x@d"cQ#X@@ !h2 &` &`!&`?&`!&`D 㿘'HH@v'$㿐 @t["J @ "`D    =  &` `@uc 5@t+` "0 ` ? ?*`@uT` $@t   @t `@"` `2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘d"SaSSPS"S@˚b@ ,-o %s: option not supported㿘@QÐ  @ S@7c0 ?L n L  o  @l = 2*@c "   G  @2   "*@ "#( 2Š S c8@ܔ @ǐ㿘@OQQQQQQQQxQpQhQ`QX unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfs㿐@w%T'#8!T@dЀ? ? oc @A@)T#&*  @@T!`@핖  @( @֐ usage: mount_kernfs [-o options] /kern mount_point 㿘d"T@Ւb@ ,-o %s: option not supported㿘@P͐  @ T@Ac 5L n L  o  @k = 2*@c "   "T @2    &*@& c@Ƞ @ې㿘@if%s: destination pathname too long0@'U%# @h? f i$p$bt$bt$p@T#&*  @@@ "bx. ?@  <   $@@@@d`@. @@O@L / /,@`?" )U@@ /  @@ΐ # p@>r@  @@@4 2 ?`@overwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%s "p t@`ؒ n"t   d"Ubx@0`"x )@`  $@ 2  @@ܒ @  O U"U"#\d"Ub@` `0d!`? "`@z4 da  "a ` `y%d耢`y ? $ @z  $耢 `y`Y2h @ߒ 8` # !U@ 2 U"@=N @e @vԀ  U@="= "@=7 @ <   @듐  U @ U# @y U#@=v 0<  @'@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set times㿈 @D6U#&@:!  U#@=/@s  @ 8# ?Ð@̒* bh #!@@"bh $"l@= n #)+Ubl@"h  bl@"cU#@<@  V"@<@1@/G @+8"#, V"@<ڒ 3 6"p V"@<͒@x V"@<Ē' '''@A耢 V"@<@ U# @Ð V "@< /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@'H 2!W!WaWDH@ U#@#Y!@N@- 6 8@[0#Y!@@<    2 @(Y"(`8@\@@d\ ?"YJ?`` `@M@e`  Y"P@@@ǒM@e`   M@* : 2 Y"@@M@ Y"@@M@`` "`` `   Y"@@M@` 2  H "`."``< 2  0 "`<Y#@@`L 2  , "`LY#0@@`4 2 H ( "`4Y#P@@Hb?2 L "b"b`\ 2 H J "`\ "`\Hb  b "b (c$ "!H" " @V  $"H"* @ "H""Ԁ 2  H@@b? $ $`p HH"* "`pH"Ȁ H#Hb̀ H"Ѐ?b!d"Y@&cp"Yc@!  $bHb? @ "b"bH Lb "8Hb?! B "b"b! L@`<Hb" $ X 8  d"YcYZ@ `d 2H"2 "`d'P'T'X '\! 4a " 0@.""$ 4! L@'$ L! 8@"$ 8! X@$ X! `@$ `@l%$ 4b `&a<` ""`4!@ L$ L!@ 8$ 8!@ X$ X!@ `$ `@$@ 0ab@"@ $`&a@0:` $ @  P@}"  @w @ @$@" .@Z@I`0'?'H"耊  '' H'\ `@?`4'`HX"`@  8@YG#Y!@W`@ ioctl (GDINFO)㿘e`e@ 613`Ta "a@ Y"@4`T0 ^@5!H"@,1"ioctl (WDINFO)%s: can't rewrite disk label㿘! 66 e`g@ ^@5\"0^"@@㿘'H'L'P'T'XH @|l   ( 8 @6  @5@71@Vݒ@ usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder 㿘 (d"^c@d"^cx@8!d"^@̒c"^@Ȓc"_@Ē`"_@`("_@`@"_@`P"_@`p"_@`"_@`"_@`Ȑ"_@a"_@a"_@a0"_@aP"_@ap"_@a"_@aȐ"_@b"_@b "_@b8"_@|bX"_@xbp"_@tb"_@pb@Z buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/'D'H'! @  $ t!@ |@ $ (!@ v@ $ l!@ p@ $ $`@Vm @E @T/ @@' o@bH@  2`@E* @+ @< ? @ : @ @ ? #!``@# 4`P ?@@ 4$`` `@`4@ *逢 "`H@ "!"! D  t?"e,"e( t "e, <"e( ``4 ``@V  @ !?`4@  t t L"` <"`` @U @ϐ  t `4`@U @Đ  tH""`0H""`4`0 "`@Uې!@  t 4 "`@UА!0@  t 4`4 6`!`@UÒ @  t 0o4`!@U@  t 0 4@ 6`@U!@  t0 "H4 "LH: : :8L: : :@"P0  t`P <"`P t" T 4  t`T <"`T t`0`T: "`8 "`` t`` <"`` t`8  0&`"`40@U^:@6  tH"$%P 02 $ t 02 $ x 4@`4$ | $ d t`d <"`d tHH"b?`4@| ?`8@w@$``4 @n?@j@$`  $``?`|@^ ?@Z@$`?$``  t`* <"` t * " t0* * ?: :0 :  #`t t:   @ %0@ C<%0 t X"|`*@"X 2: "X <  tcX: "cX <"cX tcX`@`46``x@I@`0* @ ?@@4 t x `@ړ:   @t | : @o ?  @ʐ?@Ē@a$ $ H"Ԁ   "e$ +?#`t * @L%P*  @ `,`: @`t @? @ |`,`: @`t%$  0*  @.  | `@* `,`: @ E逤@A `t`0! *"`0<`t#X* $#X.?@g@$ `t`8* "`8`` "```8 `t`t 4 0@ `t`@T"H`@T"h@ݐ `8: "`8``?"```4* "`4`|* "`|@`4@Ԓ"@0`p? t`x@(@Œ$`+`t`0,@ ?`x@@z  v `8qn!`#`@"@"b@S`t 0:$ 0 8:$ 8 `?$ `>?@@$ * @%P* @ `,`: @`t @x @ |`,`: @`t%$  0*  @g  | `@ē* `,`: @`t `@`t`t`0* "`0`@K"@`p?`x@@>{$` ( t 0* @ ? x@@, @&"@`" `` `"@S1`p`#@S,`  t`#(@S$``#@S  逧` t tH 0b `#H`@Sch tH 4b `#`@Sc@ې H""`@'   h `#a `#@R t ?@-@ʒ$  h H"" t@`"@`p?`x@@$`'%t`0* @  ?`x@@`@) `"@$`@"@p?@@$`+ t * @%P*  @ `,`: @ t @z @ |`,`: @ t%$  0*  @i  | `@Ɠ* `,`: @ t@  t`"@$`@O"@`p?`x@@E$` t @? @ |$  @9  | `@z* "a@RI @!  t 6a H@R>@  tH bĀ. h `a@R.  `` `@  a  `a a @R ta @R` h @  t* @P*  `,`: @ t @ @: |`,`: @ te$ * `@``|``@'* `,`:   te@ B`L ;   $ ``d: $`$@`|@ `$``$@`|@`$` ' t 4a@Q!@  t \"H"" 8" "LD%hL "h "X t%P@t#X* #X@p  | `@͓* %P  eh#X #\$%T%` $%X t%`"eT@"eX ! t|`* * @ ta!#\a!@aaXa`a!@QT` t"#X tDL "h X-'? t%P.#\`teL?.  teT@@eP* 2`t%P&`t t#X&۶  t@`8 z+`t@|@R@2@K@@)@@#@P@;`<L?..#\ `teT@@eP* T? `teL?2eX%` @ *eL?2`t%` eX@@`teL?..#\  eT@@eP*  ",@`teL?..#\  eT@@eP* 4`t 8`t t @ $ , @ `$ , t x ` @Γ:   $  :  ,? 4 ) t@^``,@Y`` $`&@`8$@`8a!@P^ ta"(`a@PW`@/  t ,?@5  $" L ,@@*   B`% 8*`  @ |a@P3"x@  t@  ,@@   @l 8@h 8a"@Pt@`|a@P"t`,?$`,`@7`$$`@`@L`|$`$`d* "`'  t ` d: @ | ?@ $@ a#8@O"@ t`"``,* eD `L "``02  "`l "`p t`p <"`p! t @` $ a@O#p@ #`tF!T$%\H"$ @H"$ <H"$ X d$ \ @ <$ DH"$ $"$ $ $ $ , `t* `t *``t@s"``t$  / $@q | #\a#H a#@O `t $ 4&"HhD? &"D #`#\'a#ؒ   ,@Ob  b@O[ @  t ,6/)@ 2&%b t@(``.@#```d@@=, b@O- H b P@O'd@d"@ t ,Ӑ 2b@O H @  @ @#`t$ @H`4Hb@ `t  # tT< @d*@"0@4` @  t`0` t  t , %'Ht@``.@```d,@rt ,&t D( t`4  `;( t 0 @, @@P @N @L b@ XPanic: cylinder group too big 㿘 t@s   $4 t@g``/@b`` %` $`?`4@ /  @!#`t ( @$ ($ @"U$ $ `t`,?`@}`4  ( t 2` ( t`4 &$ e$  @`8$ p ( $T t`,  $X`@eP* $\```: \ $` t%$  ( @ @] |`,`: 0` ( t @ @M |`,`: ` ?$`h (h` "h t%$ *  "l  @  | `@.* `,`: l $`d ( d"@ t @$j@MҐ @ % ( t ` ("  @"U : (`  ( \   $ +  *(` ?"`  )+ t`x```@ߓ: * `02 #@q`l, @ "`l `t 02   t@e``/@````d,`0@ `l t 8Ѥ  @-+@"Ut@ 8`(`c`(``@@t%$ `(``: `(`l  l `` ?$@ *@  + `(` $`t@ |@v * `T`(`T@@ @ "@t@|@E@^@@<@@@6@P@N* `( @F*  `(`X@t@ |@9 @%P*  4t 8@@t t`("`( t (`" ( $ (@ 8 5 8"* @ 4`" 4 8&@6(@"U : (`  ( `   $ +  *(`$ "`$ t 8@& 4&)@"U t@ 8 (`c (``@@`t%$  (``:  (`l  l `` ?$@ *@  +  (` $``t@D |@ * `T (`T@@ @ "@`t@0|@r@@(@i@"@@c@P@{*  ( @s*   (`X@`t@ |@f @%P*  4`t 8@ @ &@&@ 61 ("* @`4 "`4@"U  ``: (` ( `  `` &@ +@  *(`$ `@ "`$ t%$ ; (`h@`l@ @   `p"  t (@   $4*     *   p瀋@   t%$4*    t (` $``$ $`` $``  $`'@'` '`$'` @e``/@``` `d,`0@!㿘`x" " "  #!2`x x 4  D  I!@0 :  < H#p@( : :#`t`x 4@``x$ (`t @@ C L :` @ + 3`  3 $ hd* 4@$@ 㿘 $ @",`,   4 @ђ `@$,`@*` 2` ` @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘 t` `d!*`@C ( ( @"U@m5" (   m," ( $m%@"U `(`tc(``@t@`8@ t 8`( `(m"@J 0`t `>`t (@"U@ (``@@ t%$  (  :  (`l  l   ?$ *@ * +  (?" tĐ?" `?"`@  " "@ "@ t@- |@ *  (@"U@T  (`T@@ @?"@ t@`|@U`@n`@ `@L`@`@@F`@eP@^`*  ( @"U@@S`*   (`X@ t@ |@D @%P* @@@?6@ t 0@I 4@3 ` 8"@ @ "  8"@ ̒@ $ `( 8"@$@ "$ 8"@*` 4`"4 8(@"U 鐆 , :  (`  ( `     " (  *`t 8㐆  t` `d*`@N(fsinit: inode value out of range (%d). 㿘@@@m& l t` `d!*`@ ( ( @"U@"m@Iy"@Q  ( ?" @"U@6`  (`\@ ` *@  *! t` `d*`@( t`Ȑ?"` ?"`@0`,@ 'o @IC@ t@ @   ,@ @ @@ @ x `* @ d,@ 0@t@`x* @۔ t`0@Ŕ@o㿘@ getrlimitsetrlimit㿈#` 2&@  @]!?$` * @" @耢 6o@7"`? @耢 o@7"p""`P . P8`P" "`P@ې 㿘    @x@㿘@  @lseek error: %ld rdfsread error: %ld 㿘  @t`4 H @G0+> 4 @';  !  @ 6 p @Hpp@7D @E !!@ٔ p @Hap@75 @6 "wtfswrite error: %ld 㿘  @0`4`H@@0/ @ +> 4 @;  !  @\ 6 p @H)p@6!(@ #!@z p!0@Hp@6!(@ $isblock bad fs_frag %d 㿘 8 "  d&" !d@ "`?*  *@>*  *@>@  `? * >@  `?"pbH@} 8 clrblock bad fs_frag %d 㿘 8 >  d" d.@>*`  *` > * @ *@.@ "pc@@} 8setblock bad fs_frag %d 㿘 8 >  d" d .@>*   *  > *@@  .@ "q`@}` 8COLUMNS㿐 `h@?2  q@1 Ѐ  @F " P㿘@8ÔFailed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`I#̀?I@I?"cI"!"a""I"#)"!K!l`rq"*` dȀ  I"#)q!`-"b$ @r@!I &"c8 cqh@I?)  I "c)q!"b$&@r%!I "c8 cqI "c)" .I@#+I)"   q@Ȓa I "c)q!"b$ @q!I "c8 cq@HI)q!"b$I#̀ !)?"0 "!I@м  8cq@H"0!I#@Va  8) cq@H$0!(<  ) qb0@H$!I@#̐?$#I"#Ű?!(<  2I#I#a@   "$!(<  II "c#̒  @I ?I2 "#8# II "c"#I#Ѐ I"#K!l 2IJ))z!#Ѐ`sr"*` ˈJ)h?K!l  )!쀢J)"!\"`h!`>#@))"!)"aK!l :I#Ѐ 6J:?K!l ))!쀤  < @|V!P@)J"!,"`h)?"!! 1)!< @|D`0@> &!)a䀢 K "aK!l JJ)a " h?"`hJ)""a"hI "cذ %s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿈I#̀  K)"!"a"!l dd"@")" !I#Ѐ %I)" ) ? $  * $ @3s)s`@{@@S%I #I#@a Ia <   I04 2I)@gs"$$I@#)" I#Ѐ  Is @3)""@"I?"c! ! n)"!"aK!p IcԐ "c)" ])" K ? $  * $ @3 )""K!p  )))s`,(@z@07s!@Yb@ #))(( @()" @yF s@zva0s!@Xb@ K!pI#))"(#\#`)"#d#hsa b@?@zZa@)"!ȁ?cI#Ѐ I#؀  %I#?̒@? I"#؁Unable to truncate archive file㿘I"#I#Ѐ  I#̒  @b   I  @[#̀   8 ct@F`?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘I#Ѐ  t@F@b?!  )) tbH@F3@? Failed read on archive volume %dEnd of archive volume %d reached㿘I#؀ 3I#Ѐ I@7#̰  "!)a䀦"! "a"!@&#̰  "aI  "#8I ct@F0I tc @EԁWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘I#؀ I#@ I "#"!I"#"#I#Ѐ G ) A !I#̒  @X  2>  bI  @Z#̀ 'I$"#؀ #8#倢 `E0 8#  8 u@EN`0I"#G #    I"#ذ  II "c "aI#܀   u&`` I tc @E#0 K8I cu@EB0!p ` @   u`u`@ECannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐! q?I#؀ lK!l?  ubc!  "aI#Ѐ  4F逢 C"!a  7"a7 'I# a@ 0I/"#!` I#Ѐ I"I#̒  @w  >   @x@ dI#̒@c  II "c"!I#؀  v@Do`  uc@Dh?Foward positioning operation on archive failed㿘  >2A `(> I#؀ $9I#Ѐ 24 I#̒  @#  閃@C!  0 4 2 > 4( > 0@ b >0I#̒  @   8 cv@DAI?"cذReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐I#؀ 6I#Ѐ M  4 |I`y v@CcppI IoI`(m #̒  @   8 cv@CƔWIbII#Ԁ  v@CcHI  I#̒  @g AI8 cv@C5I@q /) "!/I`- @w< @ w@C`` I 7@uǕ< 'I# a@ I8 cwP@CpI?"c "cذ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cI#؀  'I?#̒@!? @  8 cw@C? 7 'I# a@    8 cw@Bu?7 'I# a@   I8 cw@Ba??c#̒ @?  'I8 cw@Bٔ8O??#̒@?   8 cw@BŔ;?7 'I# a@Ҕ  I8 cw@B'? `#"cؐ@a  w@Bx` ? 7@p'I# a@  8 cwh@B?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈 )b@쀢 8 cx@A8 @q  8 cx@AX! ?I#܀ )s!@Syb@ D)x"x@A$b@1)"$q@Sma "I"$q@Sfa` "II#Ѐ z x  )Ix""$@Ax "Ix"b$@@x# @@K!l? 8xx#P "aI?"cؐ y@Aah?#x@@%)'#y!)x#@@@x@@֐#x@@Ӑ#x@@А#@@ߒ, y@S` O J$ $`8O  `8O Y  s S"y`8 y`8"$ ly X@@"$xy@@ x %)@@xIy @@c%) !I#)y @@@y@@ @@, y@R̒` O"!I?"cy (@@r@)"" yy@@i y@Ra y@@_! y@,y@@V!Hy. y#䀢 @ub$$#@+" U$b$$#!@@>y could not pipecould not forkar_start_gzip: impossible-c-dccould not exec㿐@ȃ  z@'b@E  z@b(K!l   2  @<0 z@9b8@@0/!l    @' @$ z"X@ @ z"` z@b8@f@d)!Ԓ@  z@ؒbh?#p@0@ \#Kap D Uap  O)"  @  F@  A@;K )d  x@y 'K@+| "K2@0G 2@+ K@,P K2@:"@ B@ K!p ( )b@ @*Cannot chdir to %sCan't fchdir to starting directory?#p@@ l!K!p D e!p  _@7 Z)"T @5" Q@:֐   x?#@ 8 @-d/) @ *K@* &%K4u@/ǐ 2p)" )! *@hZ %)" )! ) @(@M! " (@B @$>@*O K@+ &K)@3T.!܀ )! *@h &))!܀ )!  ) @) ()!܀ "( @ ) B@)"  @M@+l % "  "@ƪ  8 c{x@>  1 /? @@  B@f )@2ߐ)" 7 4 ? "* % @*{ $%@V  K B@>@20!p <? @)"   ? "* % @*I % 2 ?# B@    )@"L 8 c{@>E0!p ( )b@ }@6@)*Unable to open %s to read㿈?'K!p  @1  @ !K!p , !p 0)"T @3 @9X  ')#d%) x@H ΀`@.X ?')"  @2 &`@O @1      @fÔ  '8| c@=0@*7 @@1` )!̀  @   @ޒ@1ڐ0  @b) @*%b $)aȐ "aȟ @``    b? "b*$b @)W $@0rK!p @@  b ? "b* $b @)2 $ 耢 2 쀢 (@耢 ` ; 7@ 2`K!p 4@S )b@ _)" @5@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. ?#p@#K@ap   ap  ~`@<0!K!p D {!p  u)" K@1r lK!p )@3 b)"  )d"~`H@p0@) "b  x@5 -K@-  2)" @1 &K  B@G K0"@2  K B@6 K!p ( @0@ )"  !)" ~ xd@(b$"5 )" @0 @& K!p D ?#p@ Cannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b??"'?#?#)bX@+,M? / /- `-,"%)X@d  8 c~h@;X0D<  ) ~c@;X08@/ 4@ /@3 *)"T @1k !@E;)?"?#  8 @-)%d+)@  ?'@, )" 2L`a 5L` /`?@"  ~c@;t`0`@ @A.@d -)"  a @@ @a @@@@@/0  @'  ?# @) )!܀ `)! #`@d]  )!܀  )!  @@ @ )!܀ @@@| `@' %b)aȐ "a)"4 @@ː` ]b Z ? O"S  @  ? @f@g` @/,  @  @c  '8 c| @:@ 0@ @@/0@@ے@ b   ? "* $ @& %b )b@ @3V@IPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 ' K!p !?3/K1  @ϒ "_?  @` La"l > @:!`!K!p $€ $!p` ``8 ( `Ȓ! !l   @9bH`! @S @K!p` ")`8@ )0a4?0 b @9۰?0aȐ "aȰ Cannot identify format. Searching...Sorry, unable to determine archive format.㿘" K XJ"K X. *` *   & .  . @  "l?K*` * "p@h`  !3K/J"@ 4 I @ C" al ? @9n`K  XK X!. * @*`@`€  .  6. 2 ?al  @9H`?   @"""  @93`?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘)a"!)a쀢 )K!p "a)!?  b)!쀊 c( ")!"  c`@8հ?0!J))!"a"h)z"$  )E )?  :")))!a")"! Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘)!"aK!l ))!쀢?   `)!쀊 a"@8{?0)&"$  ) )?))!a ")"a)  :"( ) )J? h"!Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘)"8  b`)쀢 J)a" h")a" h ))!" : @ FJ h: @j|@mh 4J @J h :@ D) &V @d )1)`/))!")J h@@"%))) !䀢 8 $ጀ@*')%)" :  '@$)J h@ ")J!`h")"!)J h"a)(@b:()  :"  K "al  b@7?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘 J lLK!l  @7raPD? !) )8?!"a)"a) :"(@ B ;"(*   :"(!))J'J%#)!2 h 4)l    @7>0` !    >? 8@ c@5 > Unable to obtain block size for file %sActual crc does not match expected crc %s( H  '" @2 8؀2  'O> c@5v'  =>)!a" @6 8 :4 )@8) )!#\ @ )!̀  )! @`#! )a"a :@ d )`)  H`4    @2 4 )` ! )?!̀ @2    a@4Ӕ  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(     '" H P2`*    *` 2  @5 8؀ 2  ' c@4'))3J!@`h !@ !#\@N@<` D`8 cp @4x / H    `@  8 c@4Y  8@  ` @4    H`4   @L㿘J p  0)!"a)"a)> "(@ B ;"( "`p !)%J#)!h ) )d J  1@r!=J`* @ !J`  $2  `27 `"4 $1  @o   $ @ (@!    & $&  @R`2 1!2& $ @ @@8= . # & 㿘J ' >1@rQ J`* @ !J`  $2  `27 `"4 $1  @>   $ @ǐ (@    & $&  @RG`2 1!2& $ @ @@7 . # & 㿘@/ "R?N MJ Ā  D@*!=J`đ* @ #J  @C˒  #J .?& $`  @׺ ` $`  @i (   @ ?`@7 , #@  $`$ $&@  $?㿘@א "R?N MJ Ȁ  D@* J`ȑ* @ #J  @Cs  #J .?& $`  @ ` $`  @ (   @  ?`@7A , #@  $`$ $&@  $?㿘@$TRAILER!!!㿘 @C/cX 2 ? H @ ?㿘   > &  & < @@-$@+@2 @- @)( (@0@   )&  $&   &  &  &  &  /  6   & H> @$ ? !?#p@ @ $@ $  " 4?ct#X#X$@ $@ $`4` ,` K!p 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘, b@0M? ݒ  @J   N    @08b0?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H  `  4!l  HH b@0 ? H,     c H &,*, N,   c(@/?070707㿘`K ` @   ?㿘 L u x  >` @% `& `  @ `& ` @ ` 6 ` @ `$& ` @  `(& `$ @ `"6 `* @ `,& `0 @ `8& @`0& & `A @a H> `; @ `$&%  < ( 2 &, H @&,., H &?^?  W㿘@%File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@& Ұ? x  >  ?  ,&  ",    A4   H A @3   bx A @  !ǒ @     @~     @t  v   @j  l $  @`  b (  @V  X " $ @L  N , * @B  D 8 0 @8  : ; @0  2 L    b       2 , , 6  b@.R  ? b@.J  070701㿘`m b@{   ?070702㿘`m b@k   ?㿘) @!"á㿘)!̀  n ђ n  x  >` @ h `& ` @ a ` 6 ` @ Z `$& ` @ S `(& `. @ L `8& @`0& & `6 @  H> `& @ 8 `"6 `> @ 1 `F @ , , @& `N @ # `V @  ,, @& `f @  `& `^ @  `H&R A`n  " | 7 < ( 2 &, H @&,.,  x H    @ b ` > ]  H    @ b ` G ?b  |㿘) @#"áFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@$ 6%?  ?  ,&)!̀ !’ @     ! @     f @     ")  ) x4& #`x H    @ b ` >   6 @    Ȓbh x  >, x  >  6 @ `     @ V     @ L   $  @ B   (  @ 8   8 . @ .   " & @ $  v   > @   k  F @   b ,  N @   W  V @   N ^ @   F n     n "   'b    '   2" , ,   , "  ɐ 6  b@,  ? b@+  `("? (8 (0ǀ2  (8 (0ǀ ?)ᘀ   ᘁ㿘ْ   x  >)! ]`* ` & `* ` &  `*`` 6 $` * ` & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, \``* ` & `* ` &  `*`` 6 $`* `  & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, `@`0 8& F& ?& >  Ր 7 < ( 2 &, H @&,.,  x H    @ b ` >   H    @ b `  ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@!w e? ?  ,&  Q  i x4f c x`H    @ b ` >   +   ; + +   ; + * 2 :+ + *    0(@( *      . q ` x  >N,+V,+,: +, + *` @*` *   @,   q x  >++++ q+ + : + + *  `  @ 2 + + *  `  @  2 + + *`   $ 2 + + *  `  @( 2 +  + *  `  @" 2 +  + *`   w, : + + *  `  @g8N +V + : + + *` @*` *   @ 2M`< + *   A+Β   ɒ  `   %a    &   2! , ,  ,   6  a8@)%  ? a`@)  Unable to create %s㿘    @R*. 6,` @  "?, -8+) $ (&@R4 6b<  @  P@) ?Unable to close file descriptor on %s㿘 B@* )8cH@( )"P  `$(  @) )" `)`  36 )"  ` @l K!t K!x  `80   @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @Q  8 c@( ?<  ,  @h  a@(Q, ?㿘    `  @O  Unable to copy %s, file would overwrite itself8 @QZ )"\   @2  @2   b@(   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@Q >%8)"\ 2P @@`@  c@'ה??<   @ %8 8@G %8* 8 c@'!? Ȗ@'ۘ?#)@ b<  ` @}`   %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8   # "X , $ (? 3* @NNNONNNOOO, @Pp2``&$   *` 2`@, @2`  aX, @   a@'# ?` 8# @ $)"<    @ 6 @', ?)"P    `$(  @  `$(  @]    x)" `)`  36 )"  ` @   MK)!@8b@ D @"r  ))@O 8 c@&Җ*`@s2` c @ma)"  6   "  K!t K!x     @K!t K!x "  `80   @  Unable to remove directory %sCould not unlink %s8@O !)"\ 2&?<  @e 6 `8  c  @Fh 8   c@@&S?8L /?  /@, / 1,@OD (@O7!  ,#?)"P@x@!  6,@O( 2 , c@a$@x ,͠ Unable to obtain file stats %sAccess/modification time set failed on: %s8J!X"!X("`K!t K!x  @N 28K!t KJ"aXK!x  J"a` c@%ЖJ@DaX 8 c8@%ÖpaxUnable to set file uid/gid of %s㿘@p 6  )!X@7b@ 8#  8)"   @n 2 ?8 c`@%?㿘@Д 6  )!X@7wb@ 8#  8)"   @F 2 ?8 c`@%h?Could not set permissions on %s㿘@ o 8 c@%OFile seek on %sFailed write to file %s㿘\I%8 2 '&4"& $& N  @ `@ L@ "`@ 2'<   @~ɖ    (@}  8@$?2&Failed seek on file %s㿘??@~  8 c Jah@}  8 c8@$Ζ㿘@ @}?&@)"   `80   File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8   @d X 8-?@@@}  :@ D @  `@  H   @"? ac@uْ  8 c"`8?#  @  a@$ ?  @} 8 c@$, ? & Unable to allocate memory for file name buffer㿘) "a)!耢  a "a)! )a "a)!؀ )a @"aJ! @z,) "a @#Òc?@ ) ?"  @H? 6 Invalid file name arguementUnable to allocate memory for filename㿘  N   `@ze   a@#?0@}?`$$N /". $$ $ $ J! Ja" J"!"a 㿘J!` "`)"D ) "a)"`    J!`J!@ WARNING! These file names were not selected:%s 㿘 )"J@J! )'d%  4   2 `☐ @#" ☒@V 2 Can't fchdir to starting directoryCan't chdir to %s㿘1J! %J@-&!!)1J#8') !d!,@q耢 "!@( 20*/! " &!.?&!!  )@"L  ! c@"`?@ ! c@"?!$!!@4 J "a File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐)a #J~"a #J"D     8J@!  $af Jڰ?a 4? E* @cDbcDbcDbxc cDcDc,c,cDcD)" Ja <@`@O Ja h Ja `@"1Ja a `@"M8Ja wX  > x>&,., a <>< < <  < (< (0< 08< 8@< @H< HP< PX< X < @@V (@P @I!JK!@!JF!@' 0 @!J;!@2!J6! &)" -a 0 @ $!J & H>&a , @zє,   8a cp@!4J*, &,  &!J! `@ޔ,&*  !`& %s %b %e %Y%b %e %H:%M%s%2u %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8)" a@U  0p `@Y)"H )` ;!@@!!"H@`  @@$ "/` Ē ` `  #\#`a @TԚ ?  a `@T `a@T`0a@T  ?  a  2a@T, 0? & * & @ @o%s%s %s @)"H 2) 8;!@[ 4!!"H 8@4 @@ "/ @Xh#@    J@ @*  ` " *  **   J 0  *J% : Є *`(8*`(8 !*`(8  0 (8/*`8`7 (А   J/ @  #  8W0(2    0 0(2      0( :( ?     J 0*J5Q Є  3`+ +`*8І8 + +`*8 1+ 3`+`*88 @@B* 0 (8/(87+ 3`+`І8@BJ/   㿘 ( 2@ ` 8W0 8W.* 2`@2 @00.* 2`@2 @ ` @ 0.:.@? %s: unknown option %c %s: %c argument missing 㿘8"#)! `)N?`"aJ -T) a *a "c)J! @ZK8) @`.  "ᰐ",?:  @%7  :2J . d"a :2. T# . d"a@@R˗:  ?8T* @ "㘐 ". > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@* /) "b@ @"b@)#`@1b@ )@ʒ0#x@1b@ )@0#"b@@Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP 9)-8 #5K@Yx8?z?`8M!*` urvhv|rvvrrrwrrrwrrrw0wLrrwhw|wrrrrrrrrs srs,rrs@rsPs`rspssrtttttttru``@-`'! `h@-@N)"!`)""``)"b$`)""T` )""\`@)""4`)""Dab@ 60 7+)))%K* :  "* t tTtTtTt(tTtTtTtTtTtTtTt<tTtDtL&t%bP%"&t$x $x %bP %" `@L@ L  HdFh@ ?@)"":@)""5@)""  0@@-@'!KJb  H@YP! $!p@ `@ d@ Kb +d)J", *b @Q-   (,  d@ 6b0Q)"" ) "a@l):    `@d@)! a @ a@W"@xѢ@)"!̢@@!(@/h J?"`l@J "`l @7a00 @ @)"!@)"! @)"!@@@F @@  @)"!@)"!@)"!@B@ @K"!lsې"/ @( BK "alqȐ % @  @@ BK  ` @ @ @ BK "al ! @ @ K "al" @@@@@ K!l KKK "apK!l`K *` yyyyydT#; c* @@ #@# $#0)T# @aX@?). @ ""XT#J c* @ޒ #@# $#J" lb:cef:hmopruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-CTAPE㿘 K "!|#+)%8'K#)7) 5)/)?Ր?Ѐ J* ~T~d}}~t~}~~}}}}}}}}}{H~}}}}~}}}~ }}}l~(}}}}}}}~4}~@}}}}}}}||}|}}~ }}}}}@}}L}t}}}}}}}}}}@` %a `h@@Sa* %a $lJ" lJ@ -  J`  $b$$b$K"!x@>"8 { @/w )"")r""P o$l@ 6k@gd$l)b  _"b )\""T$lKX"!x&  S%)O"b0)L"!J&KG"!|)D"!& "H?%"X;$b$"h7$b$"x3$b$"/$b$"+$b$"'$b$T#&* @K!l?  K@u K!l?  K apJ#"apK  "  @b@K!l   ') @ #!)@@-%b 2 @`@  $"0 ``@"0  @@ 逦 0).""0"0 " @I  6@@|@ J!@@," 2 @`@  `` . 6@@a@ 2@J" l)"$ "J @r:#)`""$J@ )"X"b$/%s8!0'@R@<L`?,@C 8#  @C!  8@y?<    8@ ?` /,`ΐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6rUnable to open file '%s' for readUnknown -H format: %scpio: Known -H formats are:H'D) ""\)""P)""K"!x)""$)""`K?"al)""< )K 7)5)1)%8/);J+d9"D@U0??ʀ DՑ* c@LXdt$@@@ @ ,8)""J"%!p)""<)"!$l)""4K"!x $lJ#%!p $l)""T$l)""\)"" &  &Ԑ |$ly&!@u&!@QbX   b`@@@   *? @\ @/|WJ@ -J` K%$I%$'b  H@U! =%!p b@R"@b , *b @L   (,  @b@<!)"!& "H&%!pT#* @K!l`G#(*` <<@ ;`@ 6@@@ 2@0-@ 2 ) @aX@)@c"bX `@@ J@J" l!d!@   *?@ J !@%s: Invalid combination of options: -%c㿘 )d"`8@Lo@'d%J"@9  6?☒`@L`L@ 0d? "☒ * "☐ @ 㿘@*@J⠀   ⠁These format options are not supported %s = %s 㿘J"  @aP!d1 "!x@L0@ Invalid option nameUnable to allocate space for option listInvalid options format㿘  N   a@  b@E?09 b0 b@<@o9.?`"+ )J'JL@ $@% , 2,@ = @n , "@"`"` " %"" `$⤰ 㿐@P  # a ]`[XJ k6` m b 0J w*J6`.  .` .  .` 6` .  .`6`.  .` (@# 'J x  *  @M @   usage: pax [-cdnv] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘!`!d@"!@"%@"#a@"!@""@}""(@y""H@u""x@q"a@n""@j""@f""@b"#@^"#0@Z"@W"#cP@S"#@O"#@K"#@G"#@C"cP@@" @<"@q usage: tar -{txru}[cevfbmopswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] file1 file2... 㿘!!d@"!@"@p usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘"X!d@""@""@"# @"#h@"@p| Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N   `@N  \`0@lt  2, `P@?0f` @cI @a:$ `@@lQ?, @qN 2 *@2`@lq *`0$@ $` +%*`:  P"` g G" `0  p"`0` $` $`@ `@lI, @D?J  $`K K`" K" "`İ Empty pattern stringUnable to allocate memory for pattern string㿘  N   b@k  2$ c@?0$ @oh$ $ $ $ K K`" K" "` WARNING! These patterns were not matched:%s 㿘 K )'d%  2 `☐ @В# ☒ @Hq  2 Pattern select out of memoryPattern list inconsistant㿘K    )"D   $ \ 2Y )"` 6K  2 *  ,K  2*@9   $ @` ` /*@5$  ` /*@$ @n$ ?J / * $ $  &           "@@kO &@I`?㿘 &K  K)"D 4)!Ѐ <?:    "   J  /2 @n`   @&     2  )!Ѐ`? &)!Ѐ   O  & ?㿘&N ?  [  **`<: /*`8: N@  )"` 5?N@ /1&. N@ ݲ`(? N *`"   N@̔ `N@ ?N@` `@ 2?N@ `? J!`? 2  *8]# 2J# -2*J  ] *8 4  @$  *8 "  *]   Removing leading / from absolute path names in the archive㿘 K!|#KN  /KN   . .  @m@n?&Ka|  K "a| @:aK!| *KN, /&K ? KN, ,  . ., , @m@nz,?&,Ka|  K "a| @aK  @C  )     ), ,@3 )"T @i     , ,@ *, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐) H@Rb@)'%#!@I @G@Eؐ@T, &@$`耢 @8 0@lǐ,@0!0O  .@(!8$  O  @!H ?!p@ @7,&* ? 㿘 @ ? ?  , ,@ ? File name %s/%s, too long㿘@N /@ ?#l @c`?@ &@ @+@ ?@ * . @+@ ?.  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s  K ?#P@*PAP X@\q 1\@@     @,`@  !X@f 6 V `0@X d\"  @L@   ː  Đ ? L@  @,  `,L@  $ `P@YP% OP OP  d"`x@D OP"`@DPOP  P,&@., 㿘H  L C  &`\`\L / 9 `\?Ѐ- . @`\2 ,@L \ &2,@  ,@` @ @ "@ @'4 7@?@* $@.Can't open current working directory.㿘@B (@9 )  "bL8 c@00)@r ()@b "K!l` *` P 0@))r ) )ԧ)Ф)"8Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘)) "b "  ah a@p@ <)" @@j LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @i 2? @+ @i 2? @ @i 2? @ @iw 2? @@g"0)"bH)"bb@ "@)b@ "@)b@ "@)b@ "@)b@ "@)b @ "@)b@@ "@)"''!'ذȐ @h 6 Ȁ 2 Ȑ @h ZȐ @h 6 Ȁ 2 Ȑ @h HȐ @hڔ 6 Ȁ 2 Ȑ @hϔ 6Ȑ @hȔ 6 Ȁ 2 Ȑ @h $Ȑ @h   Ȁ    @h  'ذؠȐ @h  @h   8 c@X?㿘K!Ȁ K@ 2 K!̀ K@! 2  K! " @F   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "V?N $!K!Ȁ 2 N!=@B  $!Ȑ :bhN # \N  #" @ 2  b@ .?  @GҔ @9@O8!=K!ȑ, @ " 2@e  2" b@?0K!ȓ,  ""  㿘 $@O!=Kaȑ* @`  $@2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "V?N $!K!̀ 2 N!=@B'  $!̐ :`N # \N  #" @e 2  `@s.?  @G< @@N!=K!̑, @ " 2@e+  2" a@M?0K!̓,  ""  㿘 (@Nx!=Kȃ* @`  (@2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘 N c@ / "N,@`N $ А ,2 J2J* .  2c( c(@  J 2 @dt  ` cP L@ 2$  *$  @ &*:  M"  c C  c m     $   $ cL@@ mS `L@  @@ $ $N @ 6  c $ "($ L #@  6   cȔ@ @@d=$   $  @  c@ .@d+?$ Ka 2KK"a"!  a" "a `@ ?K J8@  " * )  @ 6 @ &/  /@  *@  " @ &  @  " @ &    @   2 `?㿘@%@ . "$@, @g 2k?L?Г* @*`L @`=$@^?@g?`8X?!L*` DpN?Г* @*`N @ D$` d$` N?Г* @*`N @` $``?$` N?Г* @*`N @`$`  N?Г* @*`N @`$` N?Г* @*`N @`;$`@&@?? Cannot allocate memory for hard link table㿘K"  !K)@?ʒ  $"   @ (b?Hard link table out of memory㿘K" q  d " _ @LC)ǤK" ,@ 7     2   @    2  !, 0,&,*,    &   & ? $  $@@b@b̐' @b   @s  $ $  $  "$ K" , $ "   @b @ c ?㿘K" `5 " 0  + ) ' @Kǒ)Ǒ* @     2   @    2   "@bl@bj㿘K"  'K ,@ ""@`@bU@bS`2 Cannot allocate memory for file time table/tmp/paxXXXXXXUnable to create temporary file: %s㿘K" ) !K1!G@>  $" @ b?@ɐ"@+K "b$@+F@b  8 c@ 1@b?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐K" 2  1@GK"-`@ ;%K'8)2%  $  @d      @ ٔ#c?$@cӔJ @d    2   8 @ G$ E @ac  6K"$  @di  < K"$ @c8 8$ $K"-` $ " #  c@  8 c@  8 c@  ? @ R` ?@aL?Cannot allocate memory for interactive rename table㿘K"  !K"@=̒  $"  @ *b?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘K"  @ cH @&"K", @`@@ ````@` , @``@ &` cH@`  @} &@@x  &`K",  &`" @`@@` ch@ ?㿘!K" @@ؔ""* @ @ 2   &@. Cannot allocate memory for device mapping table㿘K"  !K!=@=  $"  @ ua`?㿘 @  ? Device map table out of memory㿘K" +@I!=K",`@  `   2 ` @`  K&& ",` & "  @ /b Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘 K" @ 2 "`*  ` 02% & [&V s  F5K(@_ = "" "$ 5K(  &(b(V (b(@@$L     &(#Kb(  @_n  "b(" "$  &  & c@  @c@ Cannot allocate space for directory access time table㿘K"  !K!=@;  $"  @[a?㿘K"  %K,`@ " `  u   2`a<Directory access time reset table ran out of memory㿘K" 4@Hb!=,`  2     2  @^   @  $$ $ $ $ K",` $ " @^ @b㿘K" -@H(!=K"*@ #K*" @ 2      2  ? "@ & &@^@^Ő ?Unable to create temporary file for directory times: %s㿘K" ? @X"@(/K  "b  `@@^?@'̐@^ Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxK" .  @aO  ? !ah`'7 '''3Kb @`i؀  b @`a  )a "aa@CUnable to set mode and times for created directoriespK" W )!@E!K" ??@a  =" @`F 7"   @` /" @`8Ѐ ("   @`  )" 쀢 K!t K!x  `)!@ " !K@`C" ?$" )!@ @גb㿐`@  @6` `  *   @`' *  @@F 㿘 $^ $ J$J ?`  "  @   (  ((( (  0(2      0( :( ? 㿘    .  ... . @ `0.* 2`@2 @ ` @ 0.:.@?  !   ustar㿘aN ac@`0    K Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘!#%) ") @˒ 8  @Œ`H   `P@  ` 8 `HK!l?   ` @?0 $㿘" °?` & `" 6 `& ䷔,&* `d ǔ ` /6 `l 俔 `$& `t 且 `(& `| 䱔 H > ` 䨔 `8& @`0& &   x  > >N` 1"= 2 5)8.,   &, `i,&,*, `  (  & " 6, `V,&,*, `    A6   &`   6  " 6., 1&,., &,L /  &`   6  " 6  &`    6 `x H  "@ b a >  > L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ?` 8"$*` Lhڀژڰ)! %ݰ  Ԓ` Βa Ȓa( ’aH, d ah,   ``d a  h c, c x  >   ,  @^ d /,  l   2 ?  1,  , ? c,!  | o  q%,   @^a d H |    _a x H  "@ b a >   d A C $ l 7 9 ( t - / 8  #  %!    ! &?  I ? ` `     a @w 㿘Щ ?  ?㿘C ?j  ?㿘a$?N !c@]  2?  ⥔ ,"? ?㿘 ݒ"1?  & " 6 &&NaY   aYe+ /, `,Z"@&* `d i ` /6 `| a H > ` X `8& @`0& & .aH (a)v 6.a(`t B &.a( $a  6., `l 4 &., &, x  > > ,&N``7 *` <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<  <  &`  {  &`   6  " 6? J /2i &e*N` 4   &`     &`   6 aI ᫔ aQ ᦔ `,, A& N` 2   &`  ( 6   &`    6  " 6, `j,&,*,   &`x H  "@ b a >  > `    6  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠   7c      , d c',  @' 2 ` x     >,Y  /, aY @\  ה c,`c ?` b!*` | 5,`` @[ d:aI   4 3,`` @[ޔ d , aI ږ   aQ і     6,`` @[” daI   1 2,``,  c,aaI @[ aQ @[  `|   2a   0 7,`` @[ daI @[ aQ @[ `x H  "@ b a >  `|    k` ac; a`@6  `d e  S $`l [  I (`t Q  ? 8` G  5a H  a)Η  !` ,  ! &?  ] ?        `H @ `da  ? (8/"J JJ" `4 ` /dev/ttywrFatal error, cannot open %s㿘"@)t  @cb K  "b@[b(K  "bK@J"@Y)"T   b0@2?㿘'H'L'P'T'X3Kb H@46@Ob㿘` K"@ 2. ?@ 2* %s: 㿘'L'P'T'X L) "b8)"  !)"  d@<9b$")!d"c@3@"@3 @<*" <%s>㿘'P'T'X P) "b8)"  1)"  d@<b&")1d"c@3`@"@3˔`  @d"@3R`H d@;b㿘@gK"㿘`K"@ @@V @2@K"&allocate bad sizecannot allocateallocated object too small㿘 2?@kԒa6  @. %K"a@  :(&@ @@ 2@@2@V#a 2@@k2@""@""" c"" &@ @kaȀ4"@.  @"@"@ 2#" 㿘`@kza2  ? "  ?@Xv* ` *$? $?@freeing with invalid areafreeing free object㿘 @@@2@k?c 8:  * 2?@k'`+`@2&` &?& 2?"* ?@2#  #?#LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀.J"t #.!bH@q!8? L"  P ?bH ."H* .J"w "k!@@z!`@v!h 2 @n!p@K"耥2Z$R!x 2 @9a L$@K"耥C`<! 8/!J 2/0!!@ '/'!"@XV@XS @XN .cLq`@WV @WQ@@@WK`!@Jo $'.#L`'S$' '@"@3%/'@s:@@s@ 䀢 耢``"@J; 8@H#"(@J1 @<֐ /!J@ @J /  @t젒 쀤  K@s@i`@sߐ"쀦`` "0@K can't get current directory - %s㿘.J"t%.#H@pwa8? L"  P ?H ."H*  @J9!/ /!J@  /@sƐ ! @Ւ  &  @rY  8@#@J"@ "0@J Rnprsu,ne-p: %s-u: %s: %s㿀 J e.  ` L@ - L` ` @*`:  n2L@ e2L@ E2 L@ `L@ L@   ؤ #-. "HH@o?m? 68* @$,4 #  @KP䦒 #@Im   L@   @J䦒 #Ȓ@IU !."H "H*  @^a  ."H $"H.bH?"bH."H*  '.#L`' ' 'm?#@@i4 T \2S+@L@ f0` r a"H  b 0".  \ : \;+@: \7+@ c \1+@"0  t n \(+@ v \"+@! !      @А , *: @И  `+@ \`+@`L@ `   +@` 2 +@`.+@#` "`@G 6 #@ ."0 @  )8@T 6@#@# 2 @ @$ " @ݐ pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J w`?" "(+.bH@n2? p"  v ? VbH   ."H*   2 ? 2ժ Ԁ`ְ     !.#@A@   !/"8@2@  " @9#   `"0@HA ?`!T*` @py@H+"8u"P K"h"@H "x@H@n ZW@H " @H" @G" 2 @G" `@G"@G"74@"K""&" @GՐ#   "K"h"@GƐ#"0  @G#( #8@GKK@G"2."+㿘L#R#UZ#fi#lrtuxponly -t, -u and -x options may be used with -ffunction %s %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s[%d] %s exportreadonly%s[%d]=㿐 #J r s e   t   #  .bH` "`9.!"H"H@l?k? 9] *  @@@  b  @  d`@`  +,, - '@i " '@i " .bH `bH*  `J - + `.H*J` `J@"H ?#瀊@@E#Z ."H*  $"*P @ , ,"  ,."H*  @ @@"."H,` 14`,` @@6 `  .*#,`"  @  `@` 7`,` Ԁ``1.#L 1.-)@``-@"`- "0"  @ @E  ,  @ER .#L  " -)@ "0"`@" `\`Y@EŐ "@E 0 @E 8$@E @ @E H@ P@E  @ X@E @@@E `@@E h@@E p@@E x  @Ey = "0@Es 7  `"  @Ef   @E^ `-"0@EY `-K "K@(@EL  ""0@EDK@kǐK@E="  2f ],U drtUx  -taunaliasalias: -r flag can only be used with -t and without arguments %s=%s alias not found 㿘/"8 /.-æ"h%.#.H@jx?M? 98* 000000000000000000000h00000000000000P0000000000000X0`000p cT  ."H* .#T`?  @D! ."H@j @! @`@ ``/-K 2 @@Dy @j @Du@ ` "x/.-/@ = $@`L@c͔@~.`!`@~   Ð!@DG @j K@DB"F Ð!@D<? @~  `$ " `2$ `  ?$  /b4 @6  `"@ck$   ?$ `$L~`  2adt㿐/"8 -.+).!.H@isb`? d"# t ? aHH #T> ."H*  )/@}@~ 2    ?$ 3" ?$  2@~]#/@~_ "  ?$ b ?$no arguments㿐   @B#0 @9Z  `?  lpnz㿘 ).'Ő"H@hh? n"  p ? l "H z"H  ? ."H*  2 @J "   @J 2   2bgjob control not enabled%%㿘@a`?.J"l @Bz!) .bHK@h耢 ?. "H*   @I    0!@H  .J"u" %*d %*s %s%*d %*d %s㿐`K#+ @`  #\`#`Kc+ @#\  #`Ŕ@qK bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈 `@*L@ -'%..# `*  `*: e`  #@~ 2`Ő#@ @cP "   %.#Ő"HH@gcX? l"  s ?!H@~   0."H  .,@   ."@pc`K@A" ,@ $K##!@ @d쀢  ' *` `b0#@B,@  0.J"u K" K#'!K, @A"K@A"{   ' '@E9   'K#,   @N@4', @N @4   , ." Ŕ@h B Ő#@ @A  0; 3 1 % @G! ")& @d5쀢 Ő#@@ ?6  @z4  !@M 6 !8@# @@ْ ,@`2L@㿘)"   .J"u   !)@fː"h$"hmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTINDOPTARG%s is readonly㿐.bHK@f耢 ?. "H*  P ` I!L@  ǐ@s J }!.#L  , 2 @@a8  ?.#L  ,  .#L  , &   )`*` 2`)"h  "h  *@M? @)ǐ!P@@( 0Q)"h$ @fE  ?   +// /  ?/// ? !) $"@?!x)@;bh$")"l @4!@͒ 0@/!)@bl@*$ǐ!@? .J"`    @ @˒6 lm㿘 ).'Ȑ"H@e? l"  m ?"H $ ."H*   @˖@ = "*@`@ 2   2" "4"""" ""p""""xd"h"X"Hd"@D"8"0"( bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasH f`?%s: bad numbernothing to shift㿐.#L .bHK@eD耢 ?"* ."H*  @5  6 Ȑ#@?     *"  $  " $ @># Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 %.#ɐH@d`? ? S" ."H*  2;.@xq * 2 @xm ,< Ɇ  = ɘ  . .  *  #@< "` . ``  ,. .?ɐ @?( ɐ (@?" #*    А?Г*:`  А ,N "đ, 0@x * 2 @x< 53ɮ# "`*`@@C:` `N g  o a" `I N u"`@N``N `" I H@ N w  I<<*``P@:` "A ?* :  5 * (,(<(<(<(<(<(<(<(<(<(<(<(<(<(<((<(<(<(<(<(<(<($(<(<((<(<((<( (8    I"N N  @@s-:  -", = +"  N,`N",N ,ɢ   H@N "NN _N <ɐ `@= ,@w]2  %s: not found%s: %s㿘.bHK@c耢 ?B."H*  /; b4 @0 .ʐ!0@=- "H* @ .#L  "@   `*`   2`    @Z&  8@#ʐ!@@=X 㿐 .bHK@cr耢 ?.! "H*    @C   @C    " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  +."HʐbH@c,8?3 r"  s ?* p  u @>̒Ԩ ʐ#@ݲ L ֨  @>5Ԩ ʐ#H@< ."H*  ʰ?#X&@=t .@g@ ?  `,@? ʐ#`@=4 `  '.#L`'- ' 'ئ  '.#L`' ' '?#.#쀤` x"w  ?$   $@jK`" `(`$  `@y ` $ ؐ?$@\o,?$@\d``  .J"h@?&`  @R.#`@S` ` ,`\`  `  `* ` 쀤2 ``   2 ,   2,쀤 ? *  " ,? " , ?*` *`,@1$ .@gʐ#h@; 02J"`    @ @  N@g` .,#` "`@: 䀤 @=e <``?㿘!."HK@aԔ耢 ?.#L @Pm`"H*` " @Y  trap -- %s bad signal %s㿘.bHK@a耢 ?.C "H*  K# %1 " @< `@b !p@<  ( @xI    !x@;`? `"L@ -2L` "   @x/  "@y\ 2 㿘 .bHK@a`耢 ?.; "H*  #.@^hc 2  $cȒc@;J r.#L`@?* 2  ( ``2@ !/"  @B  $" @Y@YS%s: bad value%s: cannot %s%s: can only %s %d level(s)㿐 .bHK@a耢 ?."H*   @^J G  '`.̐#@:ɒ; #L``@* 2 : 2 ` `` 2` ``2@`" 2 ` ̒c@:  ?4` ͒` @:# J b  @X55-set㿐.#L   !2 @\V *   *`?`@Z[&  &: ?$` * ޒ$`&   .J"u  /"fv㿘  #.!͐bH@`a"? f"  v ?!bH ."H* `"))ʀ@Y " $#h@:  @ [@ @ @+ 2  `ހShell: %8s user %8s system Kids: %8s user 㿈@Y@W@:z#@Q!@:t @K@:n @E@:i  %8s real %8s user %8s system x#.%.$$cx@Xڐ @$v@XӐ@$"!."@h`" cx@ "@h`" @  "@h`"K@hb㿘1)".? s.? . ?.?@,  0.@<ɒ   ` 㿘.#L $!. ."`#L . R@ $L`@EL` 2   #L . R@ " @#  #L.#L"   <8)H<0"<(=< 4$<:<4$;0;: ;2;";2;5;#,;8$;1;*|;+x;=;";O;$l;x6*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]x'Ӑ 4'Ӑ 'Ӑ! 'Ӑ!T' " `,` 2`@a  ,`@a @8b!_ ]  'ܑ,``S'ࢄ N ؟€  `$`  €   @ ؀ ̀ 0ܐ?'܀`    @  `?`?؟€  "   '@ذ㿘` @!N "" N@ *`: N`2`@ 2 ` 2``?怢 (``N@ 2N` internal error: unknown opȀ  `#А ܓ*` AlA|AB B8BPBBC,CCX@B|DCCDADDPCABEE@E|EEEEEEEG<FFN@ N`?N !`? 2@XS '4'4."`4J '4`?   @pe`?@d_`?@sY`? @WR< C  @LG< 8 @A<< - @61< " @+&<  @M<  ( @< 0 @  (@  @ $@  @ "@  @Ȁ4 ٰ̀  @ZM4  &'4 4@9'44 @’@  @@qi@ `? @Z* @`? @Z `?@@ @2 @ 4  00@,  ,@,   o&`-ѐ"*` F,FDFxF\FF0,\`?0,V@ 0,@6Q  0N0,0,@$G  0D0!, @U;@P86X@42  0/ @C)@>8$X@&   0 @1@,88@<  `?  П 㿘@㿘@䯒unexpected operator/operand㿘@  2  €  2   џ  `?㿘@ 2   €   2  㿘@ " @ ` €    @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2j  €   2\  €  2U  M €    2  ?:ؐ-   2   *€    2  ?  2     @?Ҕ  L0L(L LL)(!-a-o㿘  @ ``?  `2   Ғc.`@@ `?   $ 1 `  "㿘ܘ%s: %s%s㿘.` @  @  `&@4!H0Ӑ!P@4 O@tO0fOcOdNsNlNmNnNpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimited"%s" is not a valid limit%-20s unlimited %ld bad limit: %s㿀    )Jbb H*b S*@` a*@Ӥ!! ` *@ `*@ f-.%)H@Y? S"  a ?# H" " Ӥ!! " L" 2L  . ӒcX@3 "H* @ +`  @3#h @c #?!#c@YL Ӑ#_@)  @6: `7Ӥ!! r+#  c@?耍  2c@32 2@3#: @ Ӑ#@3ܒ 2C  #@?耤 2?耍 2? @m耢 8@#Ӑ#@3! 0$ 2 #2 2@3# : @l Ӑ#@3 㿘/А?"`"`"` "`"А "`L"Ւ`t@q` ! Kcc "c) @"b@)?*b)  COLUMNSLINES㿐)b 4."b.#b@-L#8`h@> %`K` #  "Ր    @|} "@z  Ր    @|n @z㿘)" @v ."`J` J` @` .J"| @I?@\ 㿐!81/ @Zv  # `!  @G @oΐ @C  `?㿘.@^"㿘."` .@`0 " "  *@`" 㿘 ."   ?*` : @`p N$  *@ `$ N P)"Z)" O""/!!' ' ' ' ' '.##'`'`'` '`'`'`'`'` '`$'`('#!$ $ $ $ $  'Ȕ w') "/// /L#8@vV @   @ L#8.c@vE    K@  @K` 2 ` ++ 8(8 2 J     2J2J4   2 `? Jۆ`2"@ 㿘@ / 2  ( p֤!, ,`@v  @R 0  , "F J#    " J# * `J `? 񀠠"(   J "  &J  ?  # #J *  *  #*" 㿈 n@@h  @@8 .@@@/ .P`$  @@ J? /" `@  .cL* [`''.    '%. $< L, 䠔', ''.@@"@`' .$< cL, 䄔', ''" 'P N @%.#L䡒`fileglob: substitute error(s @5!.#.#L @E5@"" $#@> ! $#@0a\ ."#.#L `'' '.#t@$  $< .cL, '', ''" '"@.L    .  2  .@; @ - J .@7 .#L%` "&&㿘 @`@  `"@FPATH㿈 @!.@7 #L`#L f`'' '.@;/@68/@1.#L  " @'  , 2/@H4@u#@w!K"耢@:"@>   &.#L㴒` N . .cL* `@',`, ,`&@  $  ,`@< ,`,`*  ,`* `@"  @㸢 @ .,`,`@*` `@$.#Lf`--@Tޔܴ ?%.,`@@R` ,`.@&@ L@F``@,`.,`@&@ . @' $< .cL, ', ''" '"@.L &;|&()㿘&'{  `& 'q  J?e`  J?  e J?  " Le`    L   e   L  "  * e L   " .N '%L \2LL  "L `*`[`?`$"LL  (2L@  L /"  L  \L  N ~ *`.@* 㿘  @;T@  * @@K@ K @" &K@  㿘 .#., @ " cL` , .#Lߒ`㿘`@; N / ?8N0 /?N /2& *&㿐@h#.@h "@Q @` cL`$< , b&`, &@&`cL@Mm`@"@`&@㿈@:ɐ '.#L`'' q'1.@H : @@:@-" @M\  2, , * /, "@@MA@9$< @ " =`  , @v ,  %@:d @;Y,#L`,,&N Trxpr`drHr8r(wrzPqxHqzqDqqqhqqLqqxqhv4qXuqHq8q(|qqlqppxpppzlpplpxzph,p`pPp8\p0p pooooooPoox\o`oXoH o8o(oooDncommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[%A"BCD㿐))"""b)"")))"""b".) "#)"# )"#t)"#x)1.# "c) *c#)K# $b!.#`D)"b)#`"@ "|)"b) b"@")"" @A )#`.# " .##"@:  *@t"@)?"c%)ۢ 03) |@  tH  )#*    * @*`@`  tc 6"t)"")""t* $t *@ *`@ @ `  00Ǔ* @*`@` ".c0))"b"@g j @HҐ 㿐 2/@ Z 0 /1)@B"??&" 㿘)#x )@ E 0>  )#**` @@ "xJ ""x 㿘#)bؐ@ )bЀ !)"Ԕ" @ @8"Ԓ@8"Ԑ@$"bؐ@$b @  ?㿘)")"@7ِ )#?@ "#)#)1)b"@`?"@)"耤)"bԀ ?@tL"Ԁ8?) "b 㿘))"b̔)@ؐ 0b 4"b)!)""@)"@"@  㿘))"bԔ)@ 0 b 4"b)"@  㿘 i) )"Ԁ   ()" c ""c `)@)"ؒ"@"")"Ԡ??  N@@3`??@!)")"ؔ"   @7)""@."))" b"@ @i ??? )@_ ??) "b)@ +"#)"Ԁ@ !)@N@"Ԁ@㿘@  㿘@ 㿘@R )b@ 㿘@I { 㿘)")"̀ @  07)"??0#")"e 䀢 $ "J@  `_2J")"J@  2`_`$"  "??#"@E 㿘)")"؀ @ݐ 05)"??0#")"e 䀢 $ "J@  `_2J")"J@  2`_`$"  "??#"㿘)"܀ )"@ ))@Y""0"Ԁ !)"Ԓ?$"@J?"Ԁ ?0)"Ԁ "J@`@V$""Ԁ"ԁ㿘@??@q ??㿘  *` @ : N       㿘)@ " )"%)#)耤 *` @: N b  㿘  @^"0  @ ^  ? @@㿘))"b̔)@  0 b 4"b))"b]" 㿘))"bԔ)@ 0 b 4"b))"bF 㿘)")"@*!)"?? $"')%)`؀ @ڒ   "@В "@ 0??$" 㿘)@"Ԙ)??")) ̀@b؀ 2J@ 0   ??" 㿘@ @ U )"ؔ *@`""؁ 㿘.@5# 㿘.@/# 㿘))"* c@%"@ 㿘))"* c@  㿘)" . #.)"*`@.# * "@@ 㿘.# .#)@; 0 "#!)"̦"@ĵ)""b%)#)@4"̐ $b$)@"#؀@z 0@㿘).#.)#"@:`"  ##|㿘))"b̀ )" {00 I-search: 㾐?/%) @#@@ G )c= @`)2 `  2??,۰?! #*,@ р   ,@Q  ̐$ O`^ B?  @ @{ @? 㿘)`#?.# %)3.@$ @~ 7̠@3L@ ^ΐD?0 ?c:@j ).c"#?㿘J@ ^`@3ѐ@3   ?@~ ?"㿘%)*#)bנ$')b$@0))b$"b") "c*)"# @ 㿘)"؁ 㿘){"́ 㿘@? 㿘)""䀦?  @))"b̀)!.)#`#|@@< #`b )"b)))"`" ")@"#!)")""̀@ )))"b)"쀦 C))"b) )"bܐ" & )%)#)b?@ )@  b))"b  ))"b̀  >  *))"b̀8 <@? )@ ??)")"Ԁ )1)?L"Ԁ8?) "b㿘))"b̀)@| 0;)"b؀.J"f !)))"b̐" !)"J?"J?"6J?"3J?" ? ?*?"*?"J?"&J"#J?" ? *?"*"J"  )? t )  t )  t 㿘))"b̖" )"ؒ" )" )"") 4")"@ <)"n ]  㿘)"Ԓ!)@E%"Ȱ)c)#l* @ ),")!)#l* "  @ $#l nothing to yank㿘)#l )) "cp)cl"#p)cp?"cp)c*  ))b"#  0@#? yank something first㿘) # 0  )@ `?0()c)#p* @2@)"" ) )#cp ?"cp"cpcp*  "cp)c)#p* u@ )))))"""b"") "#( 㿘@r  㿘C)))))"""#"#b) "*@G?  㿘.#L@Dc`   ^^2 N >  ?`  **@`?*@` N *@ )  2( ^(  @ ?*@()"%s%s = %s '%s' 㿘  K"Ȓ@$#  K"̒@$#ʐ@$# )#.   ې 0*@ *`@#( `)#.`. @#0@ @$cannot bind, not a tty%s: no such function㿘 )#@#ؐ  ۰  0! *` *  `"    2 @$Z#(  :   3) , c     2c   v ) )# @ ,   ,    ` `2N@[W 3 +  ۴ 0 *` *   " @聒    :  ; ې 0*@ *`@` ) 0@#O' ڐ)@C>bȢ)#,   ))#.,   )Mb)#,  *)#.,  "  㿘#)~b)?"c!)!֢b$#  * `` )  + c* ``c    ܚ"~)+   J  *`@ @   E*@ !)&)rb$# # +  *```"   )c *c  *c  (c (c  $*c())  㿘)# )@ 0)# bԀ))"c "֒ )"#  㿘) `)"" Ր 0@v  㿘+)b))"#)b')%)@>bܬ" !U"|$$b%b@/֐$%"D%@7%b%"$b$$@/Ő?6 @#  㿘 @b 㿘 @\  㿘 @V  㿘 @P  㿘 @J  㿘 @D  㿘 @>  㿀))"b)"Ԑ#\#`  " # 蠒 )@ 0!"W@"@E  ?%K. @ ꀦ6 Ԑ   㿀  `9+))"b)"Ԑ#\#` " # h褒 $!  b@ @/" 2  .cL@Aʔ  `` " ))"b)"Ԑ#\#` " # -B`  `0<0$@.))" "Ԑ7$@P 0# )"@"@ *? J? /K4"0@C 㿘)b "b)))"2  : Ԓ"@")"̀@*")"#)"K Н㿘KbЀ ?"b)x` `J@"xJ` ""x 4 㿘  ))""))"b쀢)Đ ) ) b ) )b?b "b)"䀢  )"`)"?@㿘)" #)b耤 *` : N 㿘  #e`   , * ? `䀦 `  ) "")""m)"")"" 㿐1)"̤#)b"̐" ')"А " A " $b* ))""b"U   ِ b  㿘)#?.#@ .#@)P 0" :@@-?@&N   " '?8N(N*  : "N? N   "`'N   " ' 0d *`:    " ') N )" 0""* : " N    "`' *`:    " ' N ?`"* : "N N    "`'N.. 㿘@ U㿘@  L㿘@ C㿘)")"؀) 0g??a )e`_`䀢 $ؔ  J@  `_2J؀ L J`@  b *``@  *`@ `*؀*)J`@   U`_`$ U J`@   *``@  b*`@ `*؀2J??   㿘)# ))")"؀ %)#) )N b؀ )"") "#)"substitute㿘!.#.#L @3ܒ@$@$`$#@-N ! @HcH."#.#L`.#t@O㿈 F.#L |`'' '耤 $< .cL, ǔ', ''" '@   $< .cL, ҩ', ''" '"@.L җ 㿈.#L 4@'' '@V":  K".#Lү`㿈.#L @'' '@7" :   0K"Ē.#L҈`expand(NULL)%S%s: bad substitution%s: is read only%s: %sparameter null or not set0  @b  .@i . J"o 2.J"k 2.J"a 2@ '.#L`'ѫ ' ' '(@ ''Ԩ?$@@>!#ē- d|N ذ  , 4@<\LTD\lĦ `N  ˲   $,@` (,@N`?$@@=ݒ,@ N `4 )@2@֡    # $,@` (,@`,@N`?$@@=,@ N ` ),@`,@w`"' '/c @ @i  @dL `?$@@=~ ,@ L `N@K  ؒ@ @a   ,  @0@_,@ "82 A 2  .cL й`" " %  5$@5 5 % 5       %" = #"   ?  ""( @`  ,@U U   %"U  = #" U B  ?"-U < @@dK @U' @$"U "P@`@@*&.cL K`@ؒ@d @d- '؀    @ @Ò"p"h@o  'N|  'x | 't ) 쀤@|z J f'^   J \'؀`W䀢 2 'ؐ `H'K# `W䀢 T `@W䀢 > ; `" `  ?"` `  "`@Jܦ ` "`@J/ܦ  @GW䀢 @!/"b 2耤`2A,`` * .c@ `  * .c@ n2,@ i,@` $@ `@$@  @@ ? `@7 ` .$< cL, ϱ&, &&" & .$< cL, ϛ&, &&@ǒ"@`& (@ ' '.cL`'% ' '΀  * .c@ z x `,߀`]!ؓ*` PXXXXXXXXpXPXXXXXXXXXXXXXXXpXXXXXXXXXXXXXXXXXXXXXXXXXXXPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA[`@9` @@3{`@0` ,@*`(`$ '  " ('@4  @2 Ͱ `'`@  2,@`,@`,@` %s: parameter not set㿈N@ M$N@ #d N` aN 2?`@ӝ [ ' *L` * @! *L` ] * @h@` @2 %. " 2. @.#L  @`@aK"@@ @'͐.J"s  2 &2& @+&@:> .cL@:O`$' N  N : . N  N.# *`  ?.# *` @ N N" 2&N ?&N@ * @$  %? = #.#L    .K"$ @  #L   $ $ $z @@ [ z L` * @t L` ]p  %? = #u.#L h`'' '@gU@` "7.  $< L, ͨ', ''@a/"@`'2" :  K"$L` @  .#Lͼ`:  $< .cL, w', ''" '$$ $L` @`?4   =.c@* @ F? A?@_@`$$  .#,  @2 "J K"耢@ + = - ?.J"s. .J"s K"耢@.# *` @2퀦  + @funny $() command: %s%R%s: cannot open $() input㿐.#L @-ޒ`"" !.@R# $#P 1V@ -` (` #`   "   @[e0@#9   @C 0 2!6 #8@@ @C8  @  @ @%'@ 2 @ϒ@8 6 &  㿘@Ѫ %1#0O>0J@8H.@ &.@U8@2     2\  @  $  @ ! L / < @(@ @8 ? @<    2. @ (*L /%< @(@2   @Ȓ8  ? @ @<  2 /,@`,@ .$< cL, x&, && .#L $@ @7"@`&@ / ,@?$@@7,@`N /"@] /  , @$@; 2,@$ @" $@7f@c@$@&@<Q @#@- F  @ <L  .  O   .2OO  O .N .@:  @$n  @"@@7@#s@?&@@ @  â@2,*+?@!㿘@ؒ  *$@@#Q @ % (`2 @`L@  @@Ͽ ` 2 @ @, , , `L@  @,@!㿈 '.#L`'2 ' 'L@ 2 *@ ` /:"*@?"@$ `@6 `*@`L@ `L` / `*@ @   @,ʑ N?$@6 2, ,  N 2@&HOMEPWDOLDPWD㿘N  +@\"p@]2 NN  2 N@\x"x@] - N  @\k"@]@ K"耦" 㿘@P.#@Q  2 @l 2   /@6b$  $ 㿘 @  ,N {#   `N { }  2N? ,2 "N  # i$0d  . $< cL, ɛ& , && ǒ"@`K& 0A= "& 4N { }- 2N? `N ,2% 2"`&.#L`@!@!@@!ߔ,f2㿘 @菔 %sPS4%s%scoprocess already exists%s is read only%s: %sX'D'H' D0H H  DR DH@\?@3ܐ /! @R DR L/""DD ` *`:`'.J" 3 .@[?"x@\r  ."@D bp.""%K#K,  @` b@C ,  .@@" @= D  !.DR DR  #L @D`#L"`  @"+ @D %D  #. %'K@ݒ 6 ' v$c  s.o.@^ D?* : ``!ē*` 4LѰѰ0LҜҜ՜<pp<(dє|֐֠DH@DH  `07H 'HH ?'H @C!.#L` 2@#L R @(  @6 #L` 2`DR !!.@d @ DH `@h @  @fH 'HD 'DDR !.#L  @'R`#L 2 HD`@@I H .H "'.DH Œ aD 'DDR HD a0А .ch@ .#L 2 @2 " . @  @2@29"(`  ` @"@  @!.#L` 2@ @ #L` 2`@ @ @ ."(" "    @  @Ր.b("b( @ $ $   $  @  .#L 2@H ?'HDH. b@,h.DH  G`0^D B!'D   @ DR `?@DH , a0CH!'HA.D "!8`? 'D '!'"'#H'#']0# 'D  .D F 0#L   '.#L 2@.#L @1^ .#L  ?  @1@1z.'.'DR &! ".D@YL $D"@` '@Z DH  a' .@ "Ő 'D@Y% @$ D"@`@ZҒDH  a'0.#L 2@.#L @0 .#L  ?  @1@1.'.'D t!@ DR@` `? .DH e a'0D  y.D Z! D H D H L a0cD ؒ D 'DD Z.DR 2U.D Ē @5   ' D DH  a01DH  a0+D D@cDH؋D @]'@PF@1aDD`@w; 8# 8D@ .@#"@'.@0"#H @ H! .J"e @0f @O _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈'H'P'.J"x   "    2 #(  @[r @Y? H [ά"Ϊ" ##.'H  P` H X@ 'HH 9#@AH   2`P 'P$H & bH@7kbH@7Ѐ p?   .J"w  bH*  "/@ 'HH ` "( H H!  .""'H쀦`@VU`H H   H(  .J"` 2`  D."`'."".`@K M! (`2 !@W,"x@X_В @?"p .`@` K"K"@? .`@` @<  @Z ` .`@ Ǒ.`/K"H .J"w  @ɤ /  c@ @'HH    0)Ԁ 0$H@ 'H D.H   H  "  H@+  ƒ`ʒ`0H  @-6 H8@# `X@O  @Jː@J @  H `@9 'H.cH'H(."cH.#L "  ` !.#L "`_ .b`J`!'H2  *`!H "'H@""@#L 2 @.A 2 .HP ̒ a."c ."cH.*bHH = "H &$2H  H@ ?"@HH @T#`H"` T*` tt.a#@.@.&@. `@0UH !.H   H@f  `@ ~@'`@ 9' @cؚ 2'J"x  #(  @Ym H@W` P )@TP .J"l " )K#X@NG K#x@NC ) 2" H` " " P@?'P ."#@- EXECSHELL/bin/sh%s: %s: %s㿘@U"0@V L /b4 @  L 2 "@  "?& " @@t78@#"H @shcomexec: %s㿘@I/!@I  c@W@㿘 .#L   @I  , 2 , @J&& &  ,  㿘 @ITӔ  2 " ?, $$  ?$ @S  `2`@J`?@R $ `$V` h$ 㿘 N = * !2N +  @I/!@I " " " FPATH㿘@H .J"z@{ /` o/!@IZ ` @2 .`W   @T!p@UK"耢@& &  @ &   ` @2  ` 2 % `0 ! .#T@I  #`   @ْ     ?& /4b ?&  `  Q M`K `  ` 2 ).#T@I )# &  &` .#P/"4 @~  )# /@-גb& &  &`@T!p@UCK"耢@  @]  )c & "c& 㿐.@I cT%/?@I      J /  ?$ $8 @騒$?@C `8# <  2?I ?<     2&㿈2&@X / ǔ ZX @ " 9Q@  '.#L`'Ґ ' '耦`;@1 : @@$@" @-E$@@ /,@`@"@@-2@y N@ Ȳ`Ʋ ! 㿘'.@$D%.$D  #.@7b!/ $!."H@2  @@8b$!$D$D%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?      .J"h  '' ' ' '''!'.J" @Rܐ"x@T퀒   @@O  8@ ?`U!*` 4<XH F" .J"m A&  @>`@肒 <  2`/-"  @ʒ `&L -  L2 #     @  `  @@N b@ &?`.J"w   c@ ?@?!`!.2x?    ` h p8@# `H@ ^?#L *R@   @  #L` *2@ "@K?`@ <`@ Ô     @@NU8@# `x@  +?@+'?`@%``` `` ΐ" @ `  @ \`@ {`  .@6q here document missingherein: yylexerror writing %s: %s㿐 ` @ za0}?s.#'  @5 0' o?@*4 .#L @) . .@6.@*5"cX?#L @ *`" ."c@ ! @ aH@6'.#t젒 !.#L@ j #L`@&"`@ '   @V 6 8@#"@  @9@6}? @'8@#!X@  '@)0  @/ ?REPLY-rreadPS3㿘  %`,` 2`%` @Q.@RaJ !@>!@Q"#@RU@ e"p#J ؒc  @Q@RBJ@ ײ @ 4K* ?K"%*d) %s㿘.` `@9 㿈  @@&      @ 4 '''."@1 㿐  2 `<`?J@ "`J@`? `)  J@   : * `*`J@ *V`  @ .` Aa|@`@ `?   $ 㿘`   "`1K "耢   t㿘Rdbteste_error: %s (offset %d)㿘 & cp@ C++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"''ܐؒ@&@x'D'L''')c''"c@(+ .#L @' 쀢 *@"@(/)  "cL 2 K@ #"@'@x1)#` ( '@t"`#"`@Ð @~)#  (D @F"@Q )@P @Q$D)@'"c end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐 Y .  ( $<T)#  '") & )# ( ))##  #@P@ #(#  //  * @*`#@)# c@)# cX)# cp)#  c)# c)# c@@& missing )zero divisormissing :㿘 [)# ߀ #@ @! : 8& " `?0& /) *& @|А )#  $ Ua@l)#`@- @c ) )#  =)#  L@ @N0F)#  =#)) h,*  1@5@C @    t@/耢  #  $  a * @  0@P 0@P`@  0 0 @ N  @   @   @  "@  *@  :@  @&    @$    @4    @6     z`?   t@   p @  l@  h@ #`  "` Ԑ@    @  R# #`  "` @v  2     7#` ?3"`  @ #`  "`  #` ?"` #  % a@6#`  "`  #` ?"` "  $ @"@O@O)2& #  ̑,missing ]㿘)# Me    e  M  2 )#"` (.c * @ <  .# M * @ 2 [ !)@T 2 `H!)#  #)@#"`@@ "c !.#L % @&@LǤc"`#L`)#f &.# *` <_.# * @ 2M#!)M_ !)#? .#L % @&f@#" }"" " @O 2. T#La`)#( '#"  J#@`#2 , @*`@`@e ) , * M@`퀤`)# )"`)#" 㿘@@H    ?$ @"@NĒ@N9 "$ 㿘N` 2@@@@2 @. *c  $ . *c  㿘!.#L ]`""" #L`" " * 㿘N  @" @b%@N} 2 @!)  #"   &@M$  *@&#" e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s( 9.#@"H"H@+T`Ѐ C8*                X                                      P              p`@a `@1 .#L@$Ԕ@Oa !@3`@! ."H* `Q @ 2 2"@!{ `J@ `@} =  .#L@$|`$@-@  2  @o!R  @ @L `C@z>` @O!2 2 22  @9!  ! @ @   @  ! 2   @@  @@  @  `? <""@ *).5)3./@$c": "@2" @@ɒ   "$@2"b@2ڔ"`@ހ@.@/{" !.#L@ؐ #L`@%"`@   8@Y#" @  @ @! "@2@"`@@@.? .8@7#@"@k J"x  ."h@J} @Ko .#`"p@ . S"#   @- 2 "@b E @ & ̔')# $'ِ' '"@@0  " $" @#K @., @*$ @ @ $"@  @.n 㿘@( )!.))' @  @, L " @@   #` "`@Ԕ @x 2, !.#@ I$#substitution failed㿈`.#L@"В`0T@4@1  '.#L`'Q ' '@j֒   $@"  @"Ē@@@ 0 @ "@@"@ $ gk%s: not in history%s: invalid range㿐@% 0􀢠 .)# "* c.*`#@.#`.@X4.#`#@3)&.#"!L ?   ..#c" : ? @} '!@( .*`#@no history (yet)㿘..#c  2. @ #X .#?#㿘..#c@#X 㿘!..## %K#)c  "/b#?$#c $؁))В..【"`: @& )). ) Ѕ*`〄"#) А 㿘..#c"< `? @ ... #@@ !1.!.,`#@ @@Ŕ " #2 @@@i "@#&@> #@#?㿘 /"..#c"<`!.. @" !.#. />$#/"b.,`@"㿘)#؀ )#Ԁ 1)@`  #Ԁ /Wb&#)@q#܁㿘!.#  / "b"/b$#.?"c㿘.# %.#/b*   @/.bb `@d*b* ? /@ b@`$ .J "*."#㿘.#@N@K @J? "!.#`/#"@` , @ C,HISTFILEr㻐.J"h N) "c)"#@F @H, )J@  );"#/@ b)"c@h` 0 -)@   $@oA,@   $` "` ^$ ڨ`?@{w%s%c㿘)cȐ  2"c..#c"< /"* ".#)#Ԁ @a .#@ )'., @ "@  , @㘀 , @=㿘'H'L'P'T'X/"!. "cN " .@ !."@/H @.j".@+א"@p 㿘'L'P'T'X@n!."@/qL @.T"@+"%s: 㿘'H'L'P'T'X/"!. "cN .@N ."D!.."@.c!."@/GH @.*".@+".#D@ ..J"u a.""D@" internal error: 㿘'L'P'T'X@ !."@.ɒ`"@/L @-"@+k"耦 @ %s[%d]: 㿘.#HJ-."c @.b .#``  $."a0@..#" 㿘'H'L'P'T'X!."@.ٔH@+-"shl_stdout not valid㿘'H'L'P'T'X/!Ȁ . b."@.H8@   <   ` 㿘  .@) .@) .@)too many files open in shell㿘@d*  8# #㿘  @B  `8#  ?̐#@ X鞐㿘 `.@*"耦`Ŕ @ Bcan't create pipe - try again㿘@:  6  8 &  & 㿘@ #@ ! bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘Ne @  "*NN  2&NА @̔ `+ ( (  %` `  2    p N  @K !&?."(?  ""(  㿘!."(`  @@ "(?$"(㿘.b(   b(` @ ?$ 㿘."(  @ ?$ no coprocess .(.0 ` ("@?㿘  .b(  b( .1."( &.@ \?&"(."(  &.@ R?& ."(  @ H?& /tmp%s/sh%05u.%03x㿘.#p  (@ 8 ,`^ & & - +.'))8c $0@,.@ٔ!  @(  & # c " &.#& .)x)h)@argument must be %job or process idambiguousno such job㿘* P"`."cl cl@  ."chch@ "@L!c@; )   ."`J`  *`  @'˔ *"` ."`J`  J` .K# !. *  `"  @;Ȕ ?. .J"l .@J"h @B 㿘 )#쀤/.)."`'. #@2$  2  2 L "L 2@@2  @6_ 2 @6X  2 `@  @X.."@c2 .!K"`L@#8 @6"."`J` @/*` j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘.J"l *@Au *  L#8 /"@ "!*  *@75*  "`8@G#  `0$ *  L! @; #L!*@Oc8 & !  @ @ 0 P8@&# a*"   !K#, *  @: ?, !*  0*. b@ +*@6K  L8@#  8`p$ .#8@b@  K8@#  '`*" *`""*.b@" *  L  `L#8 5.@@c01" .J"h   !K#, *  @: ?, .K# !, @*  ` "?2` `@:s ?, .J"h @Afork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐}=` 慒6 .ch@@ '$$$` $ )#)c"#"c@` `2$$ $$ $$$ $.#$*` "`$$($0)"#)"#@ R  0@  +8).@c c # ` #  @,` @ a @` @c  0 `?`"$ @."c$ .J"l `   $  @5>*   `L#8@ @``g@`b   @  @#.J"l ` .  !K#, *  @9 ?, .J"b `$@! `.J"l K#X @9o K#x @9j 2   8@  ” @@ @d`H)"#*" ."`* @?* @8咒`   `P@$ `8 @ ."( $0 `" " `#@v.J"h !." `p@)( #.! b x@) 2b !.@("@&X"   @ϔ @ 㿐 .ch@)#`" ` "`@  @u waitlast: no last jobwaitlast: not startedjw:waitlast㿐 .ch@])#``  `   =a  b @D   }  @|  @9 %s: %sjw:waitfor㿐  .ch@* &@)#쀤 .#  2   2  ( @t  . #@  @ #? @   ?(* "  @& @   &@㿐  .ch@Ԕ@82  @ɔ (* " ;  2  ( 0' %8 @ 6 @_  2   2  ``2  @2  @2 6  8@@# "  @ job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  .ch@O@@2` @D (* "  ` @4 7!Ű !` `(K!)'K  2$ $    !ؔ 2 K".@$Ȑ"2$` @ʒ `"` @>` 22`*   *` L#8`4@=| *  !L#8@` ` #8.c@=j  @Ԕ !L8@#!#8`^ `  ?$`)c@""c` =``@2  7`8'#` $`*   ` L#8.c@=5 *  !L#*#8@\`   8@E# b#8}` @ @8"0 0 *  ` ?$` @P @l You have %s%s%s jobs stopped and running㿘 )#쀢@ &.#."`."@` 2K ` "K "@K  2@ 2 @` 2@` "@`2`"("0"8"0"@"0"  jobs㿐  .ch@ 􀦀  @g ` @  (* " D )#쀦``    #)%. !`   @ @2 ?   "$  ) 2 )#쀤  # "@<cp 2  @  notify㿐 .ch@)#쀤 ."`#.L "    @ @b ? 8 "$  2L )#쀤 .% "@`2 .@#2" @m 㿐 .ch@e)#` ` "` @Y )#asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘)#`"  ` !!2  @bh  ) lbp0C"#) , "c)*#`8#)!)1) c쀢 #􀢀 "! " @6  # !#  b4# &# @tb*# @ϖ 㿘  &  (@ 2@& ,*` ."`#@  j_waitj: tcsetpgrp(%d, %d) failed: %s㿘 ``& `& .J"l "`  2" .@1ΐ#l/!  `   ?& @4" & `" @3 2N  `倎`ဢ`  `r&  & .J"l &*  #L  !L#*#8@<` 6  8@%# `#8]`  L  & L#8@: 4L#8`&) , L  L $  .@:ڒc , ?& S L  ` #8.c@:Д  2 ,  ;&  , .J"l ". 2. `  K#*@` .@3- . $"cx. "c` .J"l   !.@i"@!Ɛ"  .J"l `2@p8# )#쀢.#*  2 2[# 2@?@Hz  N8@)#쀢( "    2 2( ''''"@$@"$"@ @" ''''$   2     "   $ @ ?"#check_job: job started (flags 0x%x)checkjob㿘 2  a0 (@ " & `  4@`2`&  ,   "  , &  , : &    &  ? ."(`2 0"` ` 0.(` 2  `? "`(  @& .J"l ;`:. .@ .J"r ..   (.#L` ` "`R  2``2` !*  @  @] @     . @va.J"l  ` )#`  !& ?& )c "c@VaЁ%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sH /`   ,"  @#`0  ?&     )#쀦) +#2 ( -/ ( Ѐ /K    `0@# `0; 7? -:``"2/ :     ' `%/  @@#m:`  2 `2 `2      2  / `*`K@@``` ( ` @#/``@#)```@#! `2 O "`  `@#   耤` a@"   ; 7 K"!K"!0 *``   #\#\@"Ә2  @"Ē  "  28  K@"b㿘.# *` "'L@ِ)#쀦 π` , "  2 ,)#쀦 `    2 ` %` &@L`?"L*` SLTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSLTPTPTPTPTPSLTPSXTPTPSSSSSSSSSSTPTPTPTPTPS)#)#쀦 Y` U`0W@V)#쀦 L`  L 2 B` )#쀦9`  ( " @[   `"`2/&@.    2 (`@; )#쀦`  (`@ 2`߀` 2 (`` &@ 㿘*` "` `/6b )쀢`"& ` `@`2``"& 㿘*` "` @/bremove_job: job not found (%s)㿘)##쀢  "@ " a0)"@ ("  * "@" ! . #@*)c?"c* &" )c""c)c""c)쀠 쀠`"`)0)" 쀠  2"2 ""㿘 (   "@9  2 %T㿘R  (R 2 `  ".@B4@M&@`. `.@4BЁno closing quote 8 '' @'.#L`'; H' '*" *`" $ O'`  ,@` 'F' ,@`b' '%.!*J@  \ `"@ v  " # *`$ "`$%.!*J@  \ `"@ X  *`$?"`$@ .#`  ?"` .J"u a`,+.3* 7*cJ@  \` `"@ ( :   * .# .?$@@3 c#, []ebbdbdcf@fgd [; *``8 *,@@$@  >J  >.# * * : ?А >`?@2,@2,@ ;. > (.B  & .0<3. | </#L043.#J` `\ *  "@ | ; | &!,!!! & !#L `$.#J` `\ *  "@V <+ & >( &  >  $   26$ .#J` `\ *  "@/ -  $  > <  $ $    > $  |  @$ @$ $ ."#t!@`W @0J"x .#J` `\ *  "@ (!@0` $@ ."ct (t!@.#t/"D@ /"J@ ` @* `/"  @=$ 2,?/"DJ"D O` N!@''`.#@' ` .` !  } `..cL#t`1` `-/"8/bD@'u &!@ ".#!`8` "` !.# @I`$` "@"`"` #"`8$#..#Lt` @!㿘/"/"0 /#/@( b0 //""b0cannot create temporary file %s - %s here document `%s' unclosed error saving here document `%s': %s 㿐'D ͊ '.#L   !./O"/a& "a#LF #L`@&"`@ D#` '  8@#"`@ @ ǐ .#L @ 7  D@ @T@ X` %.*`$ "`$#*'D` J` `\`  #@   L  L K I@ $ @sJ` `\`  #@ @H   @`?"``* "`   @۞``?"``* "`@>( @& $"@@ =@D` *`$?"`$㿘'H'L'P'T'X/a "a.# ?  .c 8"c ? (c.#!K""룐 ."@H 㿘 <$ K"$$ $ $ $ $ $ 8?  $ $!$ 0$ 4 $ , 0 $ ( ( @ 㿘.#@J  $@#K"K"K"%.$@` r* sttuutt8tluX$@z @z`@` $@$` $`  V$``  2$@$@$`M$`$` I$`` " ` `8$` ` @ " M J@  @ J?e @ ` " `8`8$`  8$` `8$` ` @ " "`  $` ,`,``$@$`$`8!$$@`` .#L` ``8$@ 2` $`$@$` @!.@"@<"@J  v$@㿘 .J"h ,  `? " ( @  (<$ (@ s,&` & .#dK "c@#+ `."`J`  J` J`  $ & ,E.#`@ ?  & ?#'/ ("@@  @`$  "@ " (@'  ("  J "   ,$ ("  (@ Ҡ? .@ .` "#.#d K"#@"Đ  ,&& @$  ,   29&@C 5&3/!  , ` .#*` .#*@ " JJ  *@ *J /! 2  ,趒  &   @  PS1%dPS2㿐/ "! S!.0W@/Ɛ!`@0@'*   B@J "!hJ@ !2 `'J` ! `J@`'@  ` @pJ@ 怢 !@ڐ'!.#L '@ #L @y ./a "#`!.& @ 7$#`@@/v!p@0$#`㿘!.@ƒ"@"missing ] 㿐 ).'*#.##J  \  "@`l.`@{{|8}0}H}L, :  # [  *  U  *  O  *  I G  *  B`, :  [< @P 2.o#  ?&@ޒ .  L 2@.#LԒ`#J  \   "@  *  ` `2@. , @_: 0 ?&@.p 㿈  '.#L`' (' ''.%*J  \  "@[?$@t,,`:  [  ,`:  ]"? ,`:   ,  $ "%`?㿘*` ?"` .#K"耦.`#@`"@!.# `$* *  "" #" 8$#.#㿘* $  .#@J  0*` * "` .#@J  +"@'" .#J@ `" \.#J "` . * "` MAILCHECKMAILPATHMAIL0 @- @0 M@' *`< ""`<*<" > "<@-ܐ Ȁ "    *  (@-А ؀   * , $%<#   "$ @Ó 2$  2$ Ȁ    @$  2 8* 4 "*/vb* ,$  $ @d  *<  *$ *" 8㿘!*@> ($ (/@0b 4."`@! : ,@`@ % N? \ ?@~ @s   M   @ ? . @("`$(㿘 #/  b b 8 /qb$$ $ @ 2 $ <  2$ $ _%s you have mail in $_㿘! @-Œ @.   ! Ǟ !: @1 IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSIONH@80(H 0HHx`H8 xph`XPH@80(whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUnewgrp=exec newgrplogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliasTMOUT=0SECONDS=0RANDOMMAILCHECK=600OPTIND=1-iPPID-ri-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVH 0P80@ʔ@ .K# @"cH#/b @ D7ސ.@*"#L< @+K@@!.#Tb@ /"8b@ .#b@ @/!b@ @"΢", @֛` , @ , Ƞ !Ȣ!, @։` , @ , %." X$P  @   /b @$P/.#P"b4."` * * !.@w#H?#H@"@-` #H!@'b8 #H"@!` 8. *bx8#x   #`  @.Ƙ   2`@>!.."c$"@!!   @. !! "@+ @,IL /@P " @ے  P@2 T@ @)/!J@ /@ ǐ /!J /K"耤""@,a"@*ސ @+@,ؐ!@*֐#@ @,ϐ!@*͐!0U@,bx!!<!< _   @Iq/!" " "@"@*   .@+Ԑ@R # ./@,Na."`@ɢ 2  @@", ,. *bl @% .@ɐ J"c .#L `,`@$$ `" ,`@`S."#HP`@'..J"y "..#L ܒ`,`@$`  @> 0  $ . "c8@#" .("cH"` ,.#L `" $䜐   @J$ @ː  @Ɛ    ,  $  @ "@$ @u  <  !.@  !."`L  , 2@ L  "..#L ,`?@"`&"``.#H"@ݐ ."`J`*`/!J  .J`  "ㄒ`."`L "!  @R L   ."!(j   @F .J"v """ !8@)!P@*X J@    @/ @@ 2  "@) 8@*@ ` `"/!T. *bw.J"h .ℐ@  *bz@  include: %d㿀'D'H'L'P'  @ d 0 '?L  .#L` '` '.''.#'@А .#L @@ ?L@."# @V 쀢  .#L"`"`?`% *` (\(\4dd\.C #P .# 9 @1 $bL  3..#L`" `H" cL `'" cLD@`"`@/ ."c@ @{쀢 cL"`"` 㿘.#L c`"" @ shell: %dUse `exit' to leave ksh 㿈'D'HD ' ' .J"h H@ '@. 쀢 /"".#L @ @.DDK""@?`/"%"`*` 쀢  2.Kΐ".J"g .D  . .D  "`@@@ %apk."` 3//! @ D 8 L  D`  D` ?"` 쀢  `P DqD@ ?V +  L   ?' %n!0 b    &bD" H &@*   L  D ̄ ."c  V  쀢 b 2&b@/@z.#㿘 K.J"e    .K#$ K #.J"e   !.L#@2 !.&!."`#.K##LR .* #L @L +/@! c?   .  @Δ  @톒@c@#L㿘#.cL D͒`44  cL`$ $ $ $ @$cL㿘.#L` 2 .@#`@"` @&`  ` , R@`" #  $` ` R   .@ Ԕ@:.#L`"#L`㿘.#L`#L` "` ` , R@  @J $` ``2` .#L" 㿘.#L /@ @  /@!㿘!.#L@ @#L" @+ 㿘  !. #@2@  2 㿘@Eђ / 2 @ r!@Hb8@ alloc: %s㿘 'a@ؔKb"`. *2.㸄0  .( 2 J 0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 a.#*  z2  A.#*  Z2 .c` 2`'" '" '"  '"( '"0 '"8 @'"@!0123456789ABCDEF㿘1* S.'#8?@I @.@` 2?㿘   @a @}h㿘` }`*@# 㿘   *`@&  ` &   &&@ a.ceiklxXpm`CXnPfH@8b0u prshvxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘(  p( p. @C   .  . ?%-*s %sonoff㿘.`."` J (#`(#h(X@( Current option settings set -o %sx "2((߇#'آ ( p( pء. J@ " @: ,`" " ؀`'ذ .  . ."(l@4 0"X#(  pK."`( p#(L  . J@ " Bc .  2LK9"p(  p ( p."`*` J  "`K@ `**` *`*.#Lr`㿘."`J  *`3 1ᰞഀ    %."`* * * * ` @@[@@C;@@[@@G .*"ao:Ao;s%s: bad optionparse_args: `%c'-A: missing array name%s: is not an identifier㿀 *JTST)" "*T `,  `, @l( p( p,  J`  `` " * ,  2, **z)" "*z `,  `,  `,  `, @@(  p( p,  J`  `` " * ,  , *`*."`J@ -   @Bؒ / ",` J  -2,`  ,` * T z@ ."`( p@Ȕa2 `A `o`?U`0+`0(? 䀢 M䠒 , Mא  , R ʐ)"~  `s2  , , J`@2 R`@ ,  ,   )cy? %*  J - +* J` J@ - ."`J` *`!*` ' 2&쀊 2  *  "& & *   `')#4?L@ @' J  )#0?0# ,  2 *`$ -@t܀ *@*\  '*  J- +.. (  .* (Ѕ+ 8 + @*J- "@J `  %s: bad number㿘ƒ +!܅X `+ @֐@Ӑ@@$ $@.#L `u@u `?@j*+?@!㿘 U N  * ? [E  ]`2A      !"   24   ]"/ .  `(21 $ +"@  `  | )`02 `  2 * @`?㿘 0   @耦   ?"` [ *`̀ " 4 Ő_"ʰ @ʐ ð I? @   @  "   ? 2 @ $  2    x  @Ԑ@Ȕ "j   ?c 2] @ P  H 2B  @P@ G?D @ % 2 @ 2       @*`?     !`?2      22 `[: 8  - 2  ]      2  " 4 @4   2 ]2   㿘% #+   ) |?? |2  2 `b@c ` 2  * 㿘.` @㿘&@:`2` : `[*`ƀ ?$$$@ƀ `@$@$2 `$@$$@ $$̤ݦ2?$:`&@: @``$$$㿘@ "" " " " * %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`` @* ? J 2D`@* ` @ -&`J` -`J`  `@ &@&``  &` ˰?`-2`` "J`` "&`` 2 &`+2&`J`  `&`?@ &@-`   &` ` &`. : `?`: `; `, `#"N@l 2`N :2`.``U&` . 0` . 0. 8.  .:`J@ : ;> ,@* ?`J Q @* "J@&`H&@ ;2NC&` :2`.``&`P : . 0` . 0. 8.  .`@; ` K"4 ?2 J@@* ?` #2'. @* ?`J  .#*`  &`&`@* .# *` &`&@&`. > %s'\''㿘  .# * !2L L L  /_ 000 (/ 9%/."`'`P$ 2 J@   2 L@  ?&   *@`&  L  `// @%-*s%*s㿘 .#L`K# @{ " @@s` @!K!K@# "@@_ $  ..5///-K   @@6 @ @Z 6 ሔ@Q  @&۠ .#LJ`㿘`& @̼  `@L@ "` @̩& "$@b@ ,$㿘 @[6@f.㿘 #8@    c #  #@  $$c 㿘 @   ?  @ ?  㿘 d.#L$?`@  8 "c.#L’`" @   .#L } "8"c  @ .#L`㿘  @K"N@ / .'r 2N` .``*`:  / 2    L  J@ :" "@`J@  :"@J@  `&  L /"" "N "@䔐@"@C@㙔J? /@ /,@`$@ '@"@'@}J? /@ /,@` @_ @"@@d "&JV/`? 2   . /J/"J .@2@*@*@`<*@,@J"/"J.!@J/@ @ @"*@*@`*@`*@`  /"͔@ 8J@ǔ"J*@`JJ/ *@㿘   ͒ K"@ .c|@ !/"c|!/]$!/!@ K"耦.#L`㿈@Ð '.cL`' '@'@  2* /** " %㻘?&cK_N /"N Z@ / $@@ゐ``N .G`2 N .2 N . :?N /5 8?2& /. `" @e. @ #  8#  * O /  " 2N㿘@   4` @ @ ` 2@  shf_fdopen: missing read/write㿘`"`` @ɔ   "`  `0`0```  2չa(   .#L`&  d & .#L0` 0& b.#L & ,&  & & & & `& & & && $`& (shf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @c   "`  `0`0```  2Sb       (6&  2Db&  & & & & `& & &  &&`& $shf_sopen: flags 0x%x㿘   3`  .#L 0]`.#L  & ,B B ?`$ @J ,?& & & & & & @& & && $& (㿘  & @e@ &?"$  ,㿘  @J@ &?&  & & ?& 㿘     &  @  ?&  * & "~ ,㿘  &@"$ h ,shf_flush: no fd㿘! 3 1? 6 3sb(8 $"c!?@ *@&   :   @ &  & @ @  shf_emptybuf: no fd㿘!   6 37c(8 $"cw?@ `n *@&!#` $@$@2^?  *` ,  "@  &  "@  &   @ & *&  @ &  *`& =& @5  "@ %%8 @߸ 6@   (&& $&  @@ & $ 4 `  & & *@&  &  &  &shf_fillbuf: no fd㿘!2I  6 4ӥa@h8 $ "c@ R ?2+? & & !8  V   & # 2  "  4  (&8#& $&  &  & 㿘 68 (8 $"cO?@   ?2C?@*2&& 6   " : `4& 2 8&   : 2 & ( &  "&  &  & *@& @߱ 6  8#& $(&? shf_read: flags %xshf_read: bsize %d㿘 5``% 5`` 2  1?@ @ 4@&@& "& `4 @$@( ?shf_getse: flags %x㿘 5үaЀ`4  2?"+  2,# ! @ " $@ 4@޺& "& `&@`2 ,shf_getchar: flags %x㿘2  5eb 2  ? ? ?0?$    $ shf_ungetc: flags %x㿘@2@ 5@c@(2<??"9?``@2@` 20?@@ ?"&?``@2@`@&`@!"@` ?"@?*@&@`? &`*@&@`&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@? 6`Ȁ?">?@ "*`/` 6@ 6ے`@(8`$"c)?!8` @ݛ  ! 6` # @ "` @(&@#&`$ 2 `t ?" ?`?&``* &`㿘 " ?@Đ@shf_write: flags %xshf_write: nbytes %d㿘 6шbP`6 6bhр 4@ݩ&@&"&`;' ?25?@ %`@&@ &@#8 @! 6c   (&c&$&?$ 4 ` @k@&"&㿘'L'P'T'X@NLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Ȑ 7`8 Ȑ @*PCh'H'L'P'T'XȐ  B̖@H/0123456789ABCDEF0123456789abcdef(null %s)P @a@, W`7",:``%   ? ϒC&  * & <N@`.#* :  Ln* p`ߘh߸ߌxA?=":@9N@5 06/N@ +) ' *  &,: ?@, `.#-@*`,: @@, ` "N@ f` & ,  ۤ ۑ* : `S8 ؓ*` XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD,XXXX,XXXXX,(XXX,XX, Ϥ* : `k8"h*` L㌀   @o  0,@@҆ 2,:  u: -5 +0. +  04  ,@#'L@ 0"'7! 7!8  @4  ,@  X x,@ 0,@'?$@`7!P@B // @@c_%@ @"@? L@ + -  0  )?#L@3 0  ? 0 `&   @*@`& `?  @` x 0  ?*`:  `&   @*@`& `?@  0` %,  ?< ʒ`&  * & `,    `?  ?L@ `&   @*@`& ` ?`$@,  ?< &  * & `4 @,``(?㿘!*$ /@"!*"`  * $ a *"` ` ` !* ` @ $ `@{ 㿘 @70*`""`8 * |!"`@%   @^  @  @ $ *` "`* |* "`㿘ǐ $%*#* $` $`!!*  !@#   @l  "`㿘բ L'*%*฀ $Ր $ ; &! 4*  &.@# +* &! &  ` `@1 $`@,  ` @! °`@ $`* "`too many <<'s 㿘*` 2 * "`ۅ*!"`* !*- " #.ct   @?`?!@" b ct& /J"D /  & /"0/"0@ /:ᵐ"xb0" "b0.#t& 㿘*` *"`  0>*"`@i 㿈@K @ǐ @ too many redirections let%s: bad identifier forselectH !.#L R`#L @M`'' @'#L @D`''ؐ @'* 2  .@#* *`  "`* ߐ ,*"`aa 6}Ȁa! `{" !`(*! /* x! a 08!"$* !!!*  " Ҁ! * "`!.#L~`#Lz`#Lv` * " @9 -*3*."`#.).T` @" :  2! $ 2` %x&`!"! (a!;0hf;ǐ @ِ,% ٦%ؐ" :  " :  2 /@*"D "4" :  N @yct  ܠ$< #L, ה'ܡ, 'ؠ'ct"@`' $< #L, ', ''ct"@`'#L`" :  ؐ" :  " :  ؐ" :  "%@!  )  *"   ( )ۤ { }֤ @ *"  $< .cL, n', '';.cL X@2`"@`'!m  $< .cL, O', ''.ct" '@C *"  ''A!'B 'B 'B!'Y!;  @'!2 @.#t@  2 .a ;; x ;ʐ `#L/"D`$Ȑ@@e@$0$@a   @!;m@$$@0E@ ! .#t$Ȑ@̒@$@Œ@ܐ O@$$! @ɐ$!;  @S  @  Ӑ   @  !Ē .#t @!;x  ,] @% ,.#L~ϒ` $ %.#L,~$ T  @!. $< .cL, ~z', ''" '"@#.cL ~h$ ܠ$< cL, ~\'ܡ, 'ؠ'" 'ؒܒ"@.L ~J $#L~|`#L~x`㿘*` *"` ؎ *"`! {! }@ 2 㿘!, @  & @ @& 㿘*` *"` ] ,*"`!! * n @~ @ e& & "` 㿘*` *"` 6 *"`! {!  }@[  '* %*฀  $ $ @`2$`&  㿈.#L @}J`'' @'@ *` *"`  *"` (* "`).'.%*#*!  $< #L, }z', ''t" ' $` $` |ݐ!* "` $< .cL, }S', ''" '"@.L }A&  )O & *` 2 * "`׍ *"`0 !7 %S%s: invalid function name 㿈 '.#L`'| ' 'L@ 2 @쀤 > @ * :    >  @ >"ݪ?$L@ 2 @,  ? 8Ѣ` `, ̢`@֐  $ |& `6  {ؒ * "`!.#L  ``2    & @ & #L |W@& "#L |Q@& "`.#L` ?2`㿈.#L @|@`'' @'*` *"`  *"`! ;?* <"`#*1*'.%.` $` ѐ & ! $< L, |g', ''t"@`'耢  ;@ " :   .#L |`   $< .cL, |;', ''" '"@.L |)㿘@&" " "  x p h ` X P  H x   @  8 0 (    {} newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘.#/b@O ?""܀ '. T` "`@@*@’`"" T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %R?%dsyntax error: `%s' %s 㿐 *@!*" * "!.?("?$"*` ` @"`.#"`@!(@!8  >. @X@ t"܀ " @R` "@`@ 2R`@  // @b`@!hՔ*"" "   "."*  "` "`㿘.#L z`22 " " " " " " 㿘/"!*`  `?"`""//""b0."#* aliasexportreadonlytypeset㿘.J"u   a/   @@c"% , :  e , A@` , :  r , A@ݒ`  , :  t2 A@Ғ`   "  2   2 8  2  ||&&!() X ` h p x]]<>㿘*`  "`` @ AԺ *"`*  a/J"D@ ``Ja`Fa ` B.A#t:a`8`(4`) (`a.#t   @AA!!.#L @ `/0D .#t  .#tAa@:`? /*`," `2 A|.`.#L @ `@`*`$< .cL, y"`, `"@@"`@" "@㿘*` 2 * "`  @*"` !*% "  @`* `$< .cL, y "` , `"@ @"` .#t"@`"1K" 㿘 `&* "`*!"`. @`" .` ?  "t   *`(8 J *`  * " *  *  㿘"" 2 `2 @㿘 V .`x ,  $@6 .`@X 6 6&  0, `"' @ "`V  * @@ ""@@2V * @@ @"@ ?6 2 yI ֑, yB㿘T  $?*    N N@@2   @+ 2   2T *  2N  㿘T ? T?*   N N@@2  @ *@2T* @@ 2N T Tٓ*`@&  xL&& & & &  @*?4$@"R`"`"      㿘 @`㿘T` .cL* x`` T` "@  2` T`&"@< Cl, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘 K#Z"*  2 *J@ 2"** " Ė" "*`"`""#Dc"`!K# T $ T t $ t! @$! 4"$ 4" $" @@Ȕ  `@Ĕ !@  @ 㿘K#!Ԓ`"!Ԑ!Db@ )㿘#Kc @   $c."#0@㿐.# @*` Q   4 * 1K#K#   "?@s ?  㿘. K#@8#/ ""a @."#""  2/ "!."#`8@8"#㿘.# @="@K  "  @   K  " " H2 @"   timed out waiting for input㿘Kc 2 K"c Ela֐  "#/"! @."#"/"!K#      "  2@ 㿘  & 2L " @."cࠐ )."c  " !.  ! >& & !.#ߒ$#  !/v@b &  & 㿘/"!."#/"!K# $   "  " J @  㿘K#  `02` `@l  㿘 "/vb/ڒb&  !` & N@ D#    "@& `2 D#   .J"h   ?π`&   &   & @( 㿘L      @   @    @  㿘 L  @ 㿈 < ";    *`@͍耢  ``&  &     .J"h  @!"&  D& #  & '''@^  setexecsig: unset signal %d(%s)㿘   ?ϐ Fbr   ?ϲ`` & ` `"  0   2     & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %Ttime %Tcan't open %s - %s%s㻘 ?* : `G!L*`   t         p !, " " !, #, " " " # l "   #F @ch 2 F@ܔp   I#F @Δch 2> F6 `F'FF@  V FF##F @  F@ F@Ƞ  #F, c@   ,  , FؐF@s V 2  F@i   F@a   #F @Vch 2G@M`G@G GG@<  `"'GG 0@2( `   ) |@'  2G`8@```GH`GP@  !G%G#G    @ `X@  `" R@   @ ``h@     G@`Gp@ GJV `G G G@ G@Ĕ`G@ G,`G@ G!GGȐG @  G@   G@ `S @"  @`@_@ 2@ @ = @   1`  ".@ J   * "!G$: 휔: !G 8@n#  , @B! @ 2@  < <<- << >> >| > <> <&>&%s 㿘 ````` `4   @"`    0`>I!*`  % & &, % % &@I, I%I!I @IIȐI Ѐ IؒI@`2  Fh !I F#h@㿘 `2    ^ $|   @ 2   ^ $p ?m㿘 I#N  ,  )h ' ' ( (\ ( ( ( ), )4 )L )TN N`   " ` $ \BN $: (7 K*` : N A ) $% (" (  *` : N  )& ) # "   " $ {N  vN  N  }N  ( | )N㿘'P'T'X@P h'P'T'X   B蘖 @P`N`J"@`% Nŀ :*  ,0 , , , , , , , , , , , , , , , , , , ,0 , , , , +| , , , , , , , , , , , , , , , +, + , , , , , , , , , , , , , , +8 , +l h*` : fL  ^NXN`d 2 `2  `? -, B*` : @L  8N;1N! `;2(  ;*#  %`  ?  $N ?   NN N`H㿘  ] p366 T @R& ܓ&  2&   $ ?p& @8$@` 2 $@ 2&   $ ?o& @$@` 2 $@ " @`& & & & 㿘@  "oВ@ȶ KJ  ( / / / / / . . /D /p / / /J J JJߐ J J`2ֆJΐ J?@  2JÆ㿘  & ?o} &,, or&$@$`$` $`  " $` "$` , ,,&㿘 7  " oؒ  " oВ   oȒ  " o   o " @  ϒ ̒o㿘   "oo  㿘@"㿘 @ǔ/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘!L#8  @Ǖ?$#8!/ $"L" @I  8$"@j# Lb(` @ @    LbP01 @C L  "c88@j# Lbp!L#8  8@j# Lݒb@K#8?$#8L#8.nc@=㿘!L#8 @3?$#8.㿘!.#L 0nT`n'#L  2.$`M #L` $`` $`$`$$`(` 6 `2 .#L`$`,"`㿘.#L`,"`T? @``@!"?@А`@ @ʐ ?@o ?<@m.#Ln` 7 6 6 6 6 6 6 6 6 6 6 6 6x 6p 6h 6`TMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘*! /b M !؀+*M!ب ,a  " " , ,%s: subscript out of range㿐&@@  1L [-@Z ( &@!.#LΒ #Lm`#L$O #(&M#.#Lm`bad substitution㿐.#L 'L.c * @ . *Nv a$"a& .#L & . .# * @ "!L  * @  .#*@ *`*: @  * `~*`@p 0x v"`@&N"*`  : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : :."@H&  C& ? =.#<& `9&  =ڛ&3& / =@T,#L `   0`, "`  "@4 &@ !&㿐'.L c.c * @   *a$"a& L @& `' $ ,@ `  `,`` " @@&""& &  "@ &@ !&0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @ 2KV"耊"2 O@@O!8O!`* @  & `" ?.?@ .@ 2?`  #?.?@( ` .?@< .@ 0 0? -.0@@%s: bad number㿐@|?2O# setstr: %s=%s: assigning to self㿘"28  ? @ @^  @ Ocp 4 l   ?&` & @@Ӓ @z   &  &P  !&@㿘"2& *""" .cL`" ("  !&@㿘! @ T" "X?""  &@P  @ K"  L@ @`.#'e - #4 - * $42? ' * @    ?А  ?  ?ɠ?  6? @ ?L@ Ǣ`2 &@㿐2 b  & kG &   "& "!&@]%0*s%.*s%*s%.*s%-*.*s㿐@o@0@` "$``.#Lj`@0@Z @2@ e J  "8J"`@ #@ @ @@@ .#@*` P#XP#h`#\ " K",@N@e @ `  `N@  2`@@@ N@N@ 0"`Pp` ʚ@@ @@"@N /e_J @  *`@ `*J 2J0@N e`J @  *`@ `*J 2J㿘    @ü@ù  &@i & @¿ =,  $& @´ jX ENVSHELL%s: restricted%s: is read only㿘@3 " L [ =@ @ @6 .# *  ܒ`@ &  L = $.#L@Ͱ  .J"w M@{b耢 Q@{b Q@zb耢 hQ"h6`Ւ ` .@@@B$ Q2##.#Liɒ`@_ ]    @2 "2  "b ""        ?$"2b ?$ $@*b $ p$ p@2$ "  L`im   2 "" : 4& 3 b    `K  "Ȑ㿘 " i= @` `"&  ` i* i' `2& `! @ a&!@㿘 '.#*`    .# `*  ` N ` N [@5 2J2. (+. J ` (2 `JJ [ J@ `[`]2J@2J@ 㿘Ȓ J`? 㿘 @  J@ J` =`? 㿈.#L!g`''!'.#L NT E >  2:Ő ,   . " ,@ ?"@ ,  "  =&0 $< .cL, h', '' "@`'袄<,2T $< .cL, g', ''" '"@.L g㿘f*! Ғ   㿘  " "0"0 >&@bT *a,"  >@&?*  >&/b!&8Ɛ ?`T *`  Q( QD R Qh R R SL R R RD Rp RT R Qx S$ Q!/$"4 0  KL{"crrȞԐ   0q!.#p /gb$#pL /c@b2  ^@ Y<  S/eb.M"cp >&A7ѐ M" 9Ɛ!K+ /$#  ,$#  >&@D >&#*@a  $$a,! &".#d & "@ 㿘 ?`7T#*`  S S TL TL T, T8 TL TL TL TL TL TL TL TL TD T/.cP""4= 0T#Xb K "c1.#p /gb &#p˃ 0ˣ 0."#d㿘@ @`$@4$`      2       @` !f;` @P`@ >&`& `& `& & $&  J@`][["J "  㿘@kt [ .#L"@҂㿘$`Q#7?   . R  .  @(#)PD KSH v5.2.12 96/10/29 AAA  Q AA A QB㿘d$@Đ@Ԑ #-%-/!a쀢  ` $a `$a@4耢 ( @ @2 @ @  ߐ G @耢  +! a@{ ?@) a  +?!@@ +  . "  /?㿘-!耢` V!*`  YD [p [ \D ] ` ` ` [ ]P ^0-!Ԁ + - "a ^@| "- ?-!-!@D-!耢 -+!`?"`!Ԁ@@ -  *"!\*?π "a`?"a`- "a*a0*\*@ "\@- "a@ 9+!"  /" V V  @  ߰?@ ͐ -!耢 q-@ !U+!" " @"|"|@ ʔ 0U"   +!  @ `@ߞ!*@ "@  q-e    *`*` * ?<"`*a0*\*@ N"\*?π "ad?"ad- "a*0*a\* "a\J0jU"  2-6 e    *d*` * ?"d*a` !**!d"a`*!`@]ad$!`*0*a\* "a\J0:U"  -@n-"a "a耦 *-"!a0*\*@ "\  /@ ,!  *-J! -@J-"!a3,!*@-@M!- "a!Ѐ /,!`"!*!3@ +a "@" "@ Z-"!@  -!Ԁ2 /,"!+! "` !؀C,! *!3e ?J   ` ? *!3? J e @ ` ,*!3 ?K   " ,!? *!3#+@ a "@?" ,;"!! '*!3,* ` ".J"~ +!  M* " !  -* "    2++!  ^* " !  @*! *@ " +!` "`@ \ j -!耢 " -  [ 0^% 0["!*!`*@a0 "- ? 0LB B 0G@h`!Ԁ ,"!-!Ԁ@ ,@ : -"!*!``-"!-!-@Œa@ " -ۀ ?# @C!Ԁ -J! s c C- !@  @-t@   -"!@% 㿘-"!%-#-!-? $!$a$- "!,,","!"-@"!@zU U!  U   .     U    㿘/!Ѐ J/-!Ԁ *+!+!` @,@ð 0#a ?"a+!"+! @+ ? " !  +!  * !  ,a ?"a+!`?"`` "` ` "@ @%L!Ԁ/!+! ,"!  @ @" !` `" "` "`!؀-,1+!  L@  !    @ @" !"@ " " ,"ᔀ@, "+! "@" "+!" !  ,"! aY!.   g g` g` g` g` g gL g` g` g8 fh g` g` fh g` g` g` g` g` g` g` g` g` g` g g` g` fpw L"#\,a -"a,a 2-,!"a  a*a- "a-J! s c C- !?@O@ ` K +!@  E .J" + @ ƒ; +!`?` @+1?a,*@ "-!Ԁ +!+!  @ @S" !`  "` +*@ "-!Ԁ  L`` "` L"#\ ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  U"@ ` @" U"@ ` @ +! @+`2+!" U"@ ` 2@-!쀢 2@#+a!+!"@`@ a!` " `"-"!-!@۔ @?* : `ydZ!*`  { {D {` {` {$ {` {` k {` r {` rX {` k {` {` {` {` {` {X {` {` {0 {` {` {` {` {` {` {` z {` {` {` {` {` {` {X r {` rX {` v {` {` {` {` {` {` {` {` {` {` {` {` {` { {` u k m {` p p {` {` qP {` q {` {` {` {` v( {` p8 {` r m {` u {` {` u m {` {` {D {` {` v {` mP {` n n {` {` q< {` q r rX {` {` v( {` o {` r s( {` u s {` t n {` {` {` {` y@ k -!L#``, _/"8˒N` ? -!쀢 @eϒ  J  JN`@ Ȱ?@,  -!쀢`!"@"@  '/`E∢ @*`,@ -!쀢` !@@`Œ,@ ,@ -!"`"!"`- "a--!"a+!` "-` "`- "!--!"aؐ @Z+!`  Z`P@u+a"`@L` -Z XN@N`@U`c  Z`P@_+!H "` ` `@P  &K?N@ c(+N` w W"++!  Je`  +J    +! e J   2+!   +! N` %  N@ c@@ɒN@ y@+!" N@ c-~-- "a--!"a+!` #,` "`!-a!@ !+? a+- "a--!"aؠ %,#-a@q  ?   +!` ?"` ?0- "!--!"a+!`@` H-!+!`@f` !`@` !` ?"` -!  - .# "a"@-!@x? -"!-?o"a- "!--!"a-f"!- "!--!"aؐZ`P@l+a"`-S"!--a!@N -"!-aؐD"a--a!@?"@ -"!-aؐ"5"a+! x- "a--!"aN` +@ "-!  `* - "a--!"a- "a+! S- "a--!"a+!   @4" +!  @ -+! 7 !+-!䀢 +  *@.#` "``Д  +.#--!aؐ" ?"@+!  Z `Z h`Zp+!@1 $ Ȱ +! - "a--!"a+!   @4" !+!  @m !  @ -+! - "a--!"a&!+! @Q"@! @l"@!`"x"`++a"q"a-!䀢 --!@ia܀ -"!--!_"a--!@ ?"ؤ ,"!LN@"cXL#X L#X ?`?N@ N-`?-!aؔ-@uᬠ  -E?@@@Ր 0?"!-"!-)"!s? &5?h V e *`: @  2` 2 J  7e`䰆?2 * :     *`:  " J   *` *`: @  2` 2JJ  J  J  -  L e J@  2  `  "  J 2J- "a--!"a+!`` "` * : e   K 䀢`   J    ` K" @2 2 ?@+  ?  -+!` ?"`- e"a+!  @]-%+#e!- --3_'`  J `    $! J `*  * K`   $! K*  +` ?``"`@#-!+!w *!(" +!@ -.J".J" "? @Ȓ-@N -!Ԁ  +!` @" 㿘 @?* : `t^#*`  `   ~  ~ } ~X ~ ~ , d } ~ ~ `  ~  ̀+!  ?@  +!  ?@ِ  +!` ` ?@1  +!` ` ?@ +! &۰ 0LN@"cT-N`"aL#T L#T f FL L#T a4  N@ ,-`?! @   2 0+!  +!    +!` ` 6?+! `  4 0 +!` ` ?@ { +!` ` q?@  m +! ?e+!`e ` ?J  Y  UJ +! 4 2I?0G+! B @+!  6+!+! @gJ !  !+! % %+ `   ??,? @GJ`"`耤``4 0?㿘 ?%+#,!-!Ԕa @`? ? ?+!` ?"`-"!԰ 㿘-&@ "!+! ,!@  ["  { ( ) 0"  } ]  0   0 ???㿘#+a!-"$@l .a "b$"$,㿘+!"`."$"` `-@Yb$㿘 #/Zb Zb$  $  @D[  $  $ $㿘 `@_` ` & `& @&@㿘 !/Z"Z"㿐++!p"!"`"`+L@"" " "` " "`"@#!p#-!.#`u-#!$a-#`" "K# ?-$a""b"#!-""-"`K# ?@-'-K# $!-" " #/Zob$" Zjb$-" !-"  @"` @"-K-# a" ?"-""- *b- "b .""$㿘`7+!`@` 6/?+!`@` 4"` !+!` @` !+?!@   @ @" !` @"` !+!  @@!`@"` 㿘+! "+  @ @w"+!&@ " " + &++" ?  2?,?H 򀢠" ??+ [.+ e R`(@.` ` 6,` ($ 0`H 2`(@2``.H 2`` 6 ` ("H`H ` `䀢  + J + + Q+e.??H? B`H  ? 4H 4 `(@?,* `(@"# ?,  , `(@2 `.H 2  ?,  ("H  ?+ S+e.J  6  J "   &J -+("   6!? ("?  6? H 2?  6 ?("?+ + 7+e`??0H  䀢 6  J@ H  䀢  + J@ + ј?+ 1+ae`*?  H  ? !" -"!ܰ 㿘`"F?-!?@">?"`N ^    `  -"$@hҒ "? 0?ݐ!+!@$` ! " !+!@ !" 㿘-b -"* -@ @ q= q; @/ --!"a- *b㿘 -" "" @ "-@7- #- b$ * *` @{b$$b㿘+! @+ !  !+!  @T ! !-"@6  㿘 +! /--+$@2`@ :`    @' $@$@-"2  : +)+!-!  @$@"2  : !+!"㿘 `@l@ 㿘 +!-"[+- -."`!` Q+`!a!  `  `,@ -` 2,@)!H   M,@ ` -,@`  `! `  2 ,@ ^,@ ``@,@` !  a+! --!-"6   ,@ b`  ,@-!-"%-L@N@@ @<p L@ $`` +!    ++!  <   >%-L@--!b  @oߐ-a "a,-!@㿘!-!-- "@-oĐ @ -!`@1$!N@o`! @$!'-!  "!o a?@&a--!"@@`@ " N@o`! @$!-"!㿀 !*#Lc\ 2 !h!*!h@+!$!ha$c\!h "+$!h+!#\#`  s3좒 !+@a?0H*?!*"ahL "c\l! "`'K. @@     ڀ*!h 쀤 "@ $-+!`"`- "!--!"a-"!-"! 㿀  !L#\  *!l @ $#\!*#Lc\ 2!l!*!l`+P!$!l$c\ !l `U$!l`  +!#\#`  r覒 `@԰?0z:@@̰?ps-t 0i  .`s< @ @ @,`s/ @ @f "`@@0.`@@<  @rݐL "c\`?!+!*"al!"`[ `?`L "#\@J? / K"H r- "!--!"a-"!-"!) 㿀#\#`    r谒  or  @>?   .H~     M-㿘.J"~   gn-"    n ^ @n㿘. #`-"- b㿘@m m㿘-!!쀢  / TKb @ 㿘@ɔicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom(@[  ' // g@&#@  g@TcH @\c0 "` g@c`@ٱ @G%8@٭!/@';MM  /M9Mg@ h?? 3* hD H d d d d d d p d d d d d $ d d d d d d d d d d d d d d  \ d l d d 0 d d d d  4 D d $ 4 @S 0 "` g c@#$$# # @$#@I  #!g@N|  @Ւ# $#d"@@>A g@K #@ 2` gc@Խ @/ `-  `-  `- #"w$# @SG '` gc@Ԥ# g$#oc "ca/@  @N6  g@Ԏc @S& 6Pg gc@ԃ# F$## $#@ ?g# :$## 6$## 2$# @S % h`@_?#@!g h` @T#$$# @  g h`@@D#($# @Rؔ / 2g h`X@3#!$# @RƔ '  h`@#@ gT#&*  @@ @!/# @{ # ,# ,@K( 0" @Q 2 `  h`@,`@@[` @@V /0" /#  M h@`  0 "`(M  @' / h@`#쀊  M @,`@@!p?c $ p/#쀊"#< 8 !0oc "c  @   ,  *`"`0 @Z  / h@e`/#쀊 @ 0 ?c @Z /#쀊  0 ?c @Z /#쀊(< 8 /oc "cc$"c/# $ $ / h@^`#쀊$#!0 ,0   @Zl  ,<* @*@@ $ ,,`4`4`4`,` ,` $` $`/#쀊  < 8   h@*a8/Ȑ '/ɐ /0   @Z8 ( 6oh@<!p@ o#耊 0   @Z%  o h@֒ao#耊 0   @Z  o h@Ēao#耊 0   @Z    h@aȐ '0 ?c@Z 6 h@a@0 ?c@Yܘ  0 h@a ?c@Y͘   0!0'@#ĔMh" @MK  Mh"(`@MC o@ucА k@qc l@m`H@2/#쀊 20@j0  4* @@   h@E`#'0+/#쀊  @'' @͔2 *  *@ @ @ $@    @Y} / ' @Yy 6 '8# "/h@;"@/& @%@ @ 0 `/0  /@@@ 㿘8@B# k@c0 `M/#耢 0M    M !@\ 0`"  M  o@ϒcА@8"#㿘!8#@5 $#ping: sendtoping: wrote %s %d chars, ret=%d 㿘-M -- 5 /c5  "cp r5 %o , 4 'M@ <`4 @  *@ * ,0 (  @wђ M  @5`/#쀊$ 0 , 5 @5 0  /#@X  / 0l@; h0l x`@L#/#   M`@spacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x㿀  @wA  -@/#쀊!'@!pl"8@'0&@ p`p 0` "`0 ( O!o / `/ `/ `/ `/ `/ `/ `/"@'"@`''А"@@'*"@ *`" *  *  : M8@ E:8M ( (MM`M: (M 0 0M!o`@M: 0!o#M@q` : L :@` 0` "`0`?"` %o, 4 'M@Y <`4 @S  *@  , /#쀊 i "  M`@o{ '@ ϐl"`@K l"@K0 (  #@  #@ l"@J l@J"M   M El!M)l'l @ @ "@JӒ  5!M  @Jǐ"@J @  `% `  ߒ` /#쀊!  *  @@ @l"@J@; /)d+/ @ "l   l#`C "ll @J#` @` ` @* ` @@* ` @@* ` @@l@Jf#@!l@J_# '| "@? ""@* %"@ @8 Ѣ`` @` @nb' @'/b@l˔ '/#쀊  'l@J%#@ %R@ %b/"@ٔl%bl@J#P ` @* ` @@* ` @@* ` @@l@I#@!l@I# &' "@? ""@* %"@ @8; Ң`@Iߐ#Xl@Iڐ#( #`@I @ `@9`/#쀊 d@? "@ * "@ @8 d@"@ ` 3f` `: +ff:? ::3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %d.%03d/%d.%03d/%d.%03d ms 㿐d"@?`"@&  * "@7 d@"@ o0 @@I<`/o `@I7c0o @I2`0 `o@I+ /#耢`0  /o@I d0#"@ * *  @Z* o@I d@? "@ * "@ @7W 0 J0 ( FM0   :@}`8 M ( #@}  #@  #@}  #@o M 0 #@}{  #@]#\o @H㿘 @ R 0 @`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`q!0*`  | Ō  (  h Ƞ Ȱ p@GB 0 `]*`q!   0 X h x ƈ Ƙ ƨ Ƹ p@G% 0p@G! 80p@G X0p@G 0 `p p@G 0p@G  0p@G 0p@G!0p@F! 0p@F!80|p@F!`0xp@F!0tp@F!0pp@F!0lp@F"0hp@F" 0dp"8_ p@Fې"`0\  "p  " pp "pp@Fǐ"p @FÐ" p@F"  @F" "@F  '@pp.#p@F#0Kp@F#(p#H @F 0Bp@F#p0>   p #p@F#0p@F#0    2qp# 0 @F@ސ 0q@Fy X0q@Fu h0q@Fq 0q@Fm 0q@Fi 0 q  q @F_Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 , r@F,! 2`r!h2`   @F"  8 ?r!2` @F* r!  @F  '@͐!r@F ! '@Ő@F!  !r @E! d@? "@ * "@ @4> %s (%s)㿐'/#쀊   @˔  '@/"Ԓ!g@hx1/'@/"Ԓ!r@hk1/"ԁTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘l *`    *`  * r #  r *`  * #@ @E patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ esJ  D @ʦ J #\#`#d#h#l#p#t#x#|###s`Ȕ@~Ġ ? #"?#" @6 @ .` ``@. ( /#쀊 s@E! @ s#ra@D`@&as@D!<2 2 ((  `pp`? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘d"s@zc0@ 㿘@ Pgetcwd%s 㿘@x!t@ڔ ? P@T# @ @ 2t t@`@D| @T usage: pwd 㿘d"t@z]`@G 㿘@Khaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc.shutdown/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): 㿘@xg( 8J@ -"`  t@Xra1t  t"-@?!?N? 2G*  ӌ Ӕ Ӝ Ө !     @@  @B  t@a`@  t@Ēa ,t@  @S@ "t!(t! @  "  t a0t aPt!  @  " ta`@gt!ptaxt@t`` @m @ ? t@a@#ta@AV ??@? 2  t!taa@K @ @- ?@ ? 8# t@!# @  `@4@   #8?@ ? c   0 t@ .  @k!@̓ @?tt"!@] usage: %s [-dlnpq] 㿘(d"ub@x8@͐ 㿘@ dfiPRrW㿘@w/  u@Nbp" |5uu#|-p %p#p+p)p@?=? "6*  ( @ 0 @ @ @ @ 8 @ @ @ @ @ @ @ @ @ @ @ @  @  @ @  @ @ @ @ @ @ @ @ 0%$$`$$`%`|Ʀ % x@T#&*  @@@@ p@ p"`@p@Đp@L %s: %s%sfts_read㿘 p  p  p @   p x 2`@ 2v @q !#p/v-p +8@ |8 4? >* @ X ڤ ڤ  ڤ ژ ڤ ڤ  @A"  @z "2 4` "    @A @h%`   @ < Đ@ &   ` 2  4  @ <  4    p |p  |@I  @   @ @dM  ` c v @( %#  v@`%s: is a directory8`m 3p8!+p/8-v)p %<@m `x M` 7  !v@@  @J%    `p `v#@ؒ9%  8 @ ", 8 @b  p@ɐ  | @@cѐ "`   "@% ` ?c8`2 `@l p`<   @l ?#@ @`0   @ ?  ?c @d <@ d `@vŐ vp  @ @np?#@ @`0   @ ?  ?c @- M<@ d `@v ?p  @ @7p?#@ @u`0   @ ?  ?c @ <@ d `@vW p@2  p " v @remove %s? override %s%s%s/%s for %s? 㿀p  d"x`@vR.dp [< ( U@>W  "Q @z> @w @ O u"x #\d"x`@v%d@t"d!`? "`@Wѐ da  "a ` `y5d耢`y ? & @W  &耢 `y `Y "." and ".." may not be removed㿘 :#p@\ ? /2 *@@8J@@N / `J@ .2 J`  .2 J` 2    x@ " $`   &  usage: rm [-dfiPRrW] file ... 㿘d"x@uc@ 㿘@kroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !dd"y@u^`!d"y@uY`8"y@uU`p@? route: %s: %s 㿘8#!d"y@uCa "ya@u;@>Fd"y@u3a@ nqdtv/dev/nullsocket㿘@s /y /yy"(+r )r'q%r#r@|e᐀?)? "*  t | %`% H$($@$c ՐT#&* @@r@Ȳ"c r"cr @ y! @jM q  @KI q"c,q#, 6@yz!@ L@ ?`(Fy#x*`  $ t $ t $ t t t ` t t  t t t t t t t t t t t t t t T t t t t t t t t t t t t t 8r"#@l r"#@  @ 0 @K @ must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done xr# 8 "#zڐ q#,@S i e`@J@ -`@ -`?`&Zz" *`  l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l  q ,"cq ("cq $"cq  "cq "cq "cq "c#db!z!88@<#@sz!`@=ʒ0P@ ' ''' ''  ܘ @š zW @ܠ 2zO Ȑ ܘ @ 6zB ܦq#(  z@= q# z@! @=`P +q)zc( @ `,>q#`r `M 27@r# 22@ ,`$`q#,@@@@r H  c( @ @` `L@D@@=G!x @:@=A!xz@=>!@ c( p  Q(`M .p 0*@` *@`*@? `` * *p defaultiso %s(%d) %s㿐 Mc#p"cb@:ג! pb@E; . b@)  p*"  2 p{"H "H* `* `* `* `* `* `* `y*?`j{#T*`    '  {"H r ` @ϗ  @Dݒ .  p@Qb ",`!p'@J!p!@D !$, @D"@@@ p!!{@_P1p 4p!!{X@_1p!af %d: %s㿐 ?`m |!\*`   r{$"H !?  0  ??   2:@` 2``2 @:  2` '@Ɛ!p#@D] #$, @"@2@ @ p#!{@^P1p p#!| @^1p#㿐 `"J|#\*`   d d d d d d d d d d d d d d d d d d d d d d d d  d H X d ( d 8q# q# q# q# q#  q#  q# @q#ؔ r`D"`Dr qq# "qc"cqc 2"c@;$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐} Ь 'r#(8 "#z @N gq#,@7 ? }"'q%M /r `@J@ -r@ `? ,* @  @ ` ` X | l X ` L l ( 4 `  ` ` ` ` P H $㴐 $ $㴐 $  $㴐 *$ $㴐 ,$  $$ % wdq"#r" qc$ "c$`@ @@abh?2`@ ` ?2`@ ` ?2`@ `y ?2`@ `p ?2`@ ` @@Of@?2`@ߐ ` @@A r`< V"`"*`  , 8 D P \ hq#\r  q#r"q#q#0q #,J" M ",{@M#bH 2q "-,   0A  0>r`< "`<  5 ,#?` <*`  8 8 8 8 l 8 8  8 8 8 8 8 8   8 8 8 8 ` #qc @9 ,  ,cM##4 `4 r` "`#@@P 44444 4  2   #qc @ ,  ,cM# #,  `,  `,  `, r` "`#@@ ,,,,,, , , , , ,, 2   @U@Ô   2   ,@J@ ""@,@} @ ؒ  @wsq ,,@uj "&@@ /   @,@@44? ` @r֔ 2,@@4&? 2$r <  $'@Ԁ  8 @ t? q#$ @Q   "  ( @- '& ,@@8   d"b0@m^@H r q q?(*(q ( *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7 7 7 7 7 77*  7* M+  M M.  . 1A!@1q aH@%ƕ29 M#@Y  M!P#@Y  !X ` ` ` `#\ `#`@%a`. 2 @%a1q/1q !2@Yа *.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx / / / / / / / / / / / /?# @7////쀢  M M 2M`21q1O!@!c0@%>H!M#@Y   M(!P#@Y  !X ` ` ` `#\ `#`!q"@%c8L" 0 "q# :  K 0  `q"@%cX1q*"1q!!2`q@Xb!actual retrieval of interface tablex ' ''' ''  ܘ @3 zȐ @?ܠ 2z Ȑ ܘ @ 6!ܢ @ got message of size %d 㷘q "c(r# 'q@ǐ %,@Y(@5@k,uwriting to routing socketroute: read from routing socket: %s 㿘r 8"#? @"L a c  g  q `    *` *r` "`r`*`"` *`q ""`r "` q##"`$"`("`, "`0"`4"`8"`<"`@ "`D$"`Hr D"` @r q #\ ?`` q#\@(q#( @c r r  ?`` r @ q#( @uc r q #䀢 ?`` q#@q#( @Yc r r "؀ ?`` r"ؐ@Ԕq#( @=c r q # ?`` q#@q#( @!c r q #0 ?`` q#0@q#( @c r $ 2 q#(  @Sr# 29 q#,r`@  @##(+?) %qr #q!r,@"L  c @, # @,` r8@3#d"@jcH  @ q@ (J@@8rZq]/(q"@(  x  x x x  P x x  x x x x x x x x x x x x qaq䔂, 4qq] q? *qq^@ q^? @ @ *@q\"(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘q#( B `@3k (0:Mc  * X@ @3a    2 h@3U d"@ N@  T x@3I d"@ M@ @ 0   @39 d"@ M@ڔ@v route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘 qɐ#\@2ϐ! d"@h`(0"a@h  "  @1d"b(@h 0ꀢ - L  % "  "      2  2 ?` @` ڀ  ,  l@2r"@ !r  $ `@2f"X$     R@2X"p"" @2P@2M"d"@ M@"@2Bb $   L#@29 4 $   L#@20 8 $   L#@2' < @!@’# $ @  L@2# D!@# $   L@2 # $   L#@2 , $   L#@1 ( 0 " $@/  0"@& 0 $   L#@1 0q#( " @'0?H@1ܐ#!d"@ N@}"@? ""@ * $"@ @   locks: inits: 㿘@1##db@ $!M@Z#`@1#b@ @S#` L@   sockaddrs: %s㿘`B@1#!d"@N@<"@? ""@ * $"@ @ޒ  #"u@1|`  ? @ d@? "@ * "@ @ d@"@㿘 @\D>@ 6  , < ?`&  @  * & @ !  ?`&  @  * & @x 4  8  ?`&  @ > >* &@T㿘N  " @EY "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; %s: ipx %s; 㿀 ?`b*`#|   $   l@?#@H 9# '@^1#  7 7 7 7 7 7@ϐ#0 / / / / / / / / / / / /@=#@@0jd@"@㿘@@  @`!А *`: ? *`: ? *`: ?N 2    ,  ! ! ! " "0 " "*  ,`  ***".@$OpenBSD: show.c,v 1.5 1997/12/08 03:55:25 deraadt Exp $UGHRD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x ' ''' ''  ܘ @ܚ @"@ @ܠ 2@/"@  ܘ @Ś 6@"@ @/" @+ %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐 0#\ 8#`     @/ %-6.6s 㿘 L `qc "c@  @V 2 @0+   $ @є  @ @ ,@ @@  @  @L`d@? "@ * "@ @ %-31s %-5s %-31s %-5s %-5s %-26s Source address/netmaskPortDestination address/netmaskProtoSA(Address/SPI/Proto)㿐"#\!a @/bInternetXNSIPXISOX.25IPsecAppleTalk %s: Protocol Family %d: 㿘?`7#*`  't ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' '"x"" " """ `""Ȓ@.link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s   Kx  "6 H F      2 `x`@% Y `  ` @  `6Kx)' @@  ``;x@g7 `1 <+'# z`(@ @)'@`@ڒ 0@ @`@Ғ8@ xr @@.0  H@. 0 P@.p"zR"z Ж :*R@"` `*`R@ 􀢀 *@-Ё/%-31s %-5u %-31s %-5u %-5u %s/%08x/%-lu p L ` tؐ@, 'Ԥ@@6 @n+c@6 ` '@t@6  #@- @,a '@d@5 @Lc@5 ` '@S@5 #@-  '@E#0 @- xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeadd㿘 @͔ * .` *.@N p r h#  p p h r .`2 ` .` N p"N r"N hN , r N `` %*`:  , . :2 @,[6` .`?А ހ:N ,  N N A ``* 6` `,Ò @4` 6`N V` "6`N ! V` ``  `, @N V`  `$6` J\2 J /7$  *@  J  ЄЅ*(8  Є Ї**8Ѐ4*@ *@㿘@X$OpenBSD: compile.c,v 1.7 1998/02/15 10:38:35 deraadt Exp $㿘!w@!"!@9 @!ww!*` @ * $!!ww! @ * $!ԁunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )er#@9(  ` @ )b`0  ? ~  *`:       ~*`  L #"r r@  &*  *@$ "@3~L"]$ @  $@ "L ? ~8L *`:   " L   ~*`L ,2:$ " ? ~ *`:   "    ~(*`@ k $@ "L ? ~ L  " L  ? ~L $L 2  @ b ,N" " ? ~ *`:   "    ~*`2 ``*` * $ "$ ? ~8$ *`:   " $   ~*`$L r  `$ @ b@" "L ? ~8L *`:   " L   ~*`L ;"` L r c@Lr "L ? ~8L *`:   " L   ~*`L \ c8@L "L ? ~ *`:   " L   ~*`L  c`@L@<d$ "L ? ~ *`:   " L   ~*`L  @xc@c$ w! ?8$& @U!?1$8@(# c@\'r "L ? ~ *`:   " L   ~*`L  @:cr"cȠ "L ? ~ *`:   " L   ~*`L $ c@K$  ? ~ *`:       ~(*`@-c$ @  @c@r L  \ @ݒc@ $@Q` ? @ϒ`8?@@% "L ? ~8L *`:   " L   ~*`L ;zr#  @ "L ? ~8L *`:   " L   ~*`L ;2L b Rr @`XLr\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D ,  m'D, :  \ ,   cxDb :  D c@CDJ R, : J@ [DD@M 2CD @.c=DJ@ \ @J` ["%.@DJ@ \J`2J@`"'D \2 DJ` n D .@`D 'DJ@ \ @J` \D.@`'D`DJ".@D @.@`'D`DJ@  [  *@`J^ *@`J] *@` ? ]:*@J[)\J.:=!\` *@` J]*@ "J$` *@(8]2J 2J 2Jn*@`J J]2 "` RE error: %s㷐$  @s &@@.  &@@w  w@I@ @fc@w@ @*"123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   n  ,@`$@@ e&`&`w!&` @ِ , : @ =*`:  \2'N #@/N "N,@`N`    @``&&` & \2 \,@ ` 2 @`(,@` N $@$(t,@t#@Ԓ( @ @ƒ`Xmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #eD  ? ~D` J@   `'D `? ~ DJ g"  p 9 ; 1 s qDq mDm  wDg  @_b` c&@ `&` @Tb` DD@* T&@D` 'D `? ~D`DJ@   `'D `? ~DDJ  J  *'DJ * @b@W&`w! D& @Q!? &` 8@%K# c@ Db@JD ]'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ @aY 2? 3aؒc?M  (b?? ~?e *`:    ?  ~(*`?#@}@@z b(@} 0@2  +  (+?#@O   +J &@㷐 @ 'e@[( >@ ? ~J@    ` @? ~(J@ @ \2 @J` " @`J@ "  @*`J@  @"  $(ǐ, @А*@ْ unterminated regular expressionexpected context address㿐N 9 \ 06  $ /   f` 2&@ @a0&@ &@ &@@`9 &`@ӒaP whitespace after %s㿘 L@ e N     N  `. @b0& @c@undefined label '%s'㿘H#4!w# ?* :  :*  O O P P P P P P P P P P P P P P P O P O P P P P P P O! $! & @R &  b@` @}  2 duplicate label '%s'㿘  @" `,`  `,` `*`v#@ @' 2  @8` 2  @&  2 @ؐ $$ $ $ $㿘 @ ,`  `,`vc `* @ "   2  @8` 2$   2  unused label '%s'㿘 v#',` "`   @ @}a2 ``,`$OpenBSD: main.c,v 1.4 1997/01/15 23:43:12 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@X. /#h+w )w%8'w@a␀?M? /8Dd*  T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T\ T( T\ T\ T\ T0 T< T\ T\ T\ T\ T\ T\ T\ TT%a%!   @$d"@Yvb@` T#* @w!؀  ` @`@ `M@  @@`@ 0@ @Zw!@ d@;"@  8@"Q# @b@) r%s: %s"%s" ..."㿘O  aw  w0#!Lw!L w "!w!L   !wH!w!L @#+a`w  "a !L8@"# ah@ ww!L "aO "`w!Lw!( p@E w@!x !x*@ `* `* `* `* `*ww!("aww!L "a$O "`@ waĔ _"aL@ #[L` nWwU"!waL"aLw@;! O" .waĐ "aD!Ā w!$J@ # wJ` nOw "aаwOww  $J  $ @ !L$@V #!L.aĐ #a.. $ "$aĐ #a.`"$װ stdin㿐w!H Bw'w%wd!)w P >w P$H%!%!@"aa`  $H!!8@!F# !h@H`? "`@9 H@  "@w@:HP $P @faHw!Ȁ  !w& i  "ae w `"a!H@"t!H @w!8# " @! ah@@waĐ "a%w'wd!)w H`? "`@9 H@  "@$w@:2HP  $P P$H%!%!@!ݒa` $H!!8@ # !h@yH @aH 㿘@& " " "O"@"㿘@ " O"@" "$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%s㿘@z  8@ # @=`@㿘  @z  8@ p# @'`@㿘w!X "@z@oX #w$aX@oOaXsed: %lu: %s: 㿘'L'P'T'XL!d"@W.aH 4 !d  ww"aP@W!!d"@W"@Wa` @} $OpenBSD: process.c,v 1.3 1997/09/11 11:21:07 deraadt Exp $%s%s: %s %lu 㿀w"!'w!t-w5w/w+w!`1d  w$!̀`w3w@ "@ `?Ƒ* : `C#*`  e< e< e< e$ e< e< e< e< e< e< ` e< e< a a4 e< e< e< e< e< a e< bT e< e< e< e< e< e< e< e< e< e< e< e< e< e< e< e< ` c `l e e< e< ` a aP e< e< a` e< ap e< b( b c ct c e< e< c dP d e< c e< e<  *`&*`@ *`%ἑ*` * $ $$` w! ",@"H%`  't @dW 1t?$ " $@~ rwta`  ta`  a`t@ @a`t@ @"H` @t@w!Ѐ   t @"@@tȒ  2$@}  @ t 2@w!Ѐ   t @"@@|  2@t @}"@@ 2@t @c t?$$t @f"@ 2$@w!Ѐ   t @T"@@@|   *`&*`@W*`%ἑ*` *  $` $ @|y` $  t%@a n&aa "k@&a` 2d@`?t` & @K!? $`8@# bPY` `t@z G8@# bPI` >@a`  ta`bX @  t''' ''a`$t $ $ $  $%a`% % % %  2@tL` @,  @w"`a@U@`bw!Ѐ   t @"@@F $\%d not defined in the RE㿀w  !tw! w @ w"aĐ aw  @!x w "!w!x   g?0T!w-w!` !@ @"@  @!@! @! $ !@` !Ԑ   @b !  $    @M `.w!(#wa $  @7 ?a#wa w!t$ !w! @.  !@a ! $ @" w!t!t''' ''w"!t`"`"` " `"""`"`"` "`"    d@̖@ `0w!| 2- ` ?2  & @I! ? "`  8@B# bP  wat at@y    8 @.# bP  rstdout: %s?c w!@?d'w)d? ἑ,`* @  (`ἑ,`*  @m"@`,`@*`  @a蠒  @  @V"@@68`w!@d"L @ 8# " @ aww"!"aCOLUMNS\ \ \abfnrtv%03o㿐!O ?2 @w#h " @B$ `h@y2  O`O" O <"` Ng%d#O @#p N`e @J  `\ @`?"`` @* "@@ Ɛ 7 #x \@`?"``@* "@@  \@%N "L@`?"`` @* "@@   #@8  N Od"@?`"@ $ $* "@ w d@? "@ * "@ @ g d"L @ 8# " @ afirst RE may not be emptyRE error: %s㿘  ,  q'w:` & \  ?Ne @  ?`Ԁ \2  N \ &2    & : & &  , 7 ,` ? Ԑ  ?"/ԓ,` `?2` ?"$ԑ,`@` `$ "? @ @&   & &  ԓ,`  @ @z' & , `   &  & &  ,㿘 ` @d&  & &"&  @@y & *@%s: %s㿘?'%8?N  w"!  { s" /"* + ?" @w    @" hٔ " ?"& @w "&  @ hƔ& 2N 㿘w"!  2   2  "c  2  "+  2 watat  @v  2 g   ww!@ \ !Ȁ W  *@$ w "a 2 watat  @M  2 >   ww!@ 3 !Ȁ .  2  w!@ w"!  $  2  watat  @ @  ww!` `?! 2  `?㿘  w!   b "! J? "?w!Ԅ  : :w!w!  w@@hM  w0    a b㿘@  wh w`  wX wP wH w@ w8 w0 w( w  w  w w  w v  v  v vwerasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard w w wrprntflushbrk㿘@/@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀'a  %@Xu 2cp  @Xk 2] `&` 2 N#@@ N u2 N@.ƒc "  N <2  @.`  @4 ? @8 `  @@ J  0@@  @* (N ^ @N  ?  - `  *(@* ( &` illegal gfmt1 option -- %sillegal gfmt1 option㿘  @Wb@@Tb`gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘"  @ !! #  b@   2 @S@S"@’:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@! : 'H H  'H%H@.c L @!В = 2,@,@`c@ؔL c i@-c 2Ls&  i2 L@-ؒc 2Lf& i2L@-˒c 2 L@U& $ l2 L@-c 2LH& o2 L@-cȀ 2L;&  o@-cЀ  @*& (!! " @@LJ@2` @- 2` `? @h` * @ 2@@ HH gttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@-6@illegal option -- -%soption requires an argument -- %s㿈L@ -2&` &`@'O`ؔ  @V#L 2 # 2  ` #h@@ *  "  &  &`#@@  @ 㿘  D @ۖ 㿘  " @0"@&   &  $$ >& $ & 㿘@ 6 F &  * + * - * 0 $߄C" $ "  " 㿘  D @ 㿐   '`` '``@s & 㿘 @ @QK &    ("  "  $@ ( "   "  $@" $ "   "  "  "  " 㿘 @ @Q & 㿘  @0 @Q   ?` #&  & 㿘@f 6 D &  `"  ""  $ g" $ "  " %d %d 㿘# D@ F%d 㿘@P @#؁TIOCSETD㿐' `@s$  @˾`TIOCSTART㿘@s`n  @ˮ`HTIOCSTOP㿘@s`o  @˞` 0 (         # 3 # 3 2 3 3 # @ @ @ x@ p h ` P H @-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5           @ @ x p h ` X P H @ 8 0 (       -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk X P H @ 0                @ @ x@ h@ ` P @ 0 (    @ @ C$ C C$ C    p h `-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho         x p@ h@ ` X P H-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘  Ȁ  @)  2   ` *@&`   L&`  #4#4  @( 2   `*@&`  3&` !!  @( 2   `$*@&`$  &`$ "`"` "  @( 2   `*@&`  &`&`    tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ @%```" `"@!@!@! @}!@y!Ȥ@L@L !@l!@f"@@^`" @W"  @V"(! 4  `"0@_@  4  `"8@T@$ 4 `"@@I@  4  `"H@>@  4  `"P@3@  4  `"X@(@  "`@@  4  `"h@@ @ 4  `"p@@  4  `"@@" 4 `"@@ 4 "@@4  `"@ܐ@4   `"@А@4  `"@Đ@4  `"@@(" 4 `"@@@"  4  `"@@! 4  `"@@ @ 4  `"@@  4  `#@}@" 4 `#@r@$ 4 `#@g@( 4 `#@\@4  4 `# @O@  #0@E@  4  `#8@:@  4  `#@@/@  4  `#H@$@ "  4  `#P@@ @#X  #`@ @  4  `#h@@ 2  4  `#p@@ @ݐ#x(2 #4 `#@@ #!""  4  ` # 4  ` ####@4 `#@Ð@4  `#@@4  4  `#@@4   `#@@$ 4 `#@@4 @ `#@@4  `#@{@! @a#!! %@`@  d@3@a` @ 2@@F 0B@C ! !1 d ( ,``@"` %@3@`@a @3Ȕ 2 `  @@` @ ڀ! @ @(㿘!w!耢 @" $!w"!%s: %s %s %s㿘!w!耢  w"a@$!@m! H @Ր""@ђ  !w"@ʒ! $!%d㿘 ?  1w! @3b&!w1 #  M*` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1w!-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@D'H 'T"#T#6>T#T%8c* H@J ``c* H@l@+H@Mh?$ e"  f a T# gT# @;  ' `p@T T#cT#*`H 'H@d  @l`x`@k  @3``h@k쀢 `@c `" ` H 2 'M'''H IH   8HH 2H! ,HJe @ `  H@S @Hݒ@Hޒ'`@l8   HH`' @@@4H 'H     @9  @ö`   `g@k쀢 @ @lW usage: stty [-a|-e|-g] [-f file] [options] 㿘d"@EW`@lA 㿘@㿘@C@a@l/ 㿘@            x p h ` X P H @ 8 0 (        !    " # $ % &)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@B@@#c 2??. @@"c耢 .  @c&@?`V*`   d_ `JZ`?`J@ !A!wJ` >``JL@ `J@ !J` /!w@2`w! (!wR  %`w@"a2`?`J@ !!wJ` `@` w! !wR   `w`@"a@ !w`$!@`@(`?!@  `$!` @`%s: %s%s㿘  J  @bb0 b8@] 㿘@"!w!`$!@` $w !`$!@`2  @ a?"a㿘@!w!`$!@` #w !`$!@`@ a?"a㿘 ""w@ !"!@`?argument expectedclosing paren expected㿘  % c %2w!w!`$!@g`!`$!@_` &M nc0H!0wR ,wwa"a  Yc  w !0 %w!!@j "`?@U@_@!@# w! " wR  w@ !@i@ 㿘!w! $!@ w!!`$!``2c?* : `y"8*`  |  ( P x @!k]`?@!eW@ @!_R2 @!Z 4L  0I@@A`?@ߐ@ܐ8@ @֐@Ӑ60  0-@̐@ɐ4&  0#@@$  0@@&  0@ޒ @@8`  @8 2o b(@7 f `V p*`     $ , L 4 < D      @ h9`?, *(&$"0'(%$#" Ȁ4" ̀ @@@`?  < `? @ 㿘 !hw"! "!T @  w  w"! '%s: out of range%s: bad number㿐!8$#@ #  bX@KJe @ `  `'J`   J  bp@- ؠ @7. @7)8X@4  ؠ @7 @78X@&  ؠ @7@78 8@< `?㿘@malloc><@=!:illegal -m option format: %s㿘@t@d  2$ @``wc 2xx"c"#pcp""cp$ $ @ `h  $ i$ @$  !t@?ߑ* :  9* @ 0 D D D D D D D D D D D D D D D D D D D D D D D D D D $ D $ ; $  5 $     $ IJ`N@ : $  `@F :  .@`@m$ N@ $ , : $    "$  `p@=㿘w#`I#d%8` "` @> 2;@` 2*   & T ` `?T `6   T `4   T `$   T `&  "@``2`㿘N B" @ !write to stderr㻘 @5  @%@e$   @e˒? @h @@f㿘d"`? "`` . :  @* "@@㿘 !x@^?#<#<  " , x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x#< `" * x<<?# @#@"< ? "? @k" # @a"  @{ kbbcbsos㻐'#H@= J` #P@=`J`  @@=#X` w" w@=#` wx #O  @=#X w b?"bwb  b, :  " "b"x #O xw"  x#<w""   `*x #T xw"  x#<w""   `*x #Q xw#  x#<w##   `*UCLCEPOPNLHDpt㿘@=*!p x " << "< @=!x  xc<c<*"c< ?"xc<c< ?"c< !& @=!   * & @<!  x<  "!x#< `& #<!$#<  & `& @<ߐ! "   ?& #< >$#<@<Ӑ! xc<` ?"` @<ɐ! xc<` ?"`xc<`  "` pcrsisrfif㻐'#p@< 8*aX@Zx#l * '#x@<  #@<  @:U '#@< #@<    d"?`"@&  * "@ǒ d@Y"@Ԑ stctchcmOOPS%s 㻐' @"(#J@ ^ #J`  ` ?  #J% #J@ ^ #J`  ` ?  #J%#J@ ^ #J`  ` ?  #Jm$@ "0l#fc a _ ] @mZT#&*  @@b@쀤=@9"@1x#h&#h@9"H!x#8$#8 `h@aE  #8  #h    77 `g@a0i!x#<wc@(3 ,   @8#<쀤 L :@bP  ,@v 2, @bX"`@r`d"bh@;V" @R " @M " @H  "@O@ 쀦 @_" "@a?@b 2""##@0@@,@b %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐x#<@ w#@`:!"3db@:a'"@8 O O  b@:Вb0  d"@:ǒb 0 d @"b0@:0"bH@:-e^H-i^C-k^U6xH-2(  "H-2  Heik2 H2 Hi" "ke"" ""  2Husage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘d"@:[`x@aE termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@  : '@e * '!! '%D@’ dN D@( D0@"@?`"@ : :* "@` %e#!d@a8 N   N N倢 E* @ , @ h | T Ԥ Ԥ Ԑ@!@@!HFN@!PAN@!X !# @$ݔ!?"c8d"aP@/X@?#P "b@"#P"  P!@#8P  "bP"  !P#8@b@T#80P" dRbN$" L@ P" #d P"Ā cdP"Ȁ cdd"aX@/ #xcd PP"`?"cdP"Ā !@U#  @U# !!#d"ax@.-Q!+)P'%1#Pt#8€`L 2P" h #@ @#8 $b"#|?"b@Ty#8P" 2 P@Tq L P@P"؀? PP" F@2#x0B"Ā 8P"Ѐ d"@.aPP"  #`@"  |#|`@" "@d@P"Ѐ dP"  d"a@.nxd"@.ichP" @#%s: %s: warning, name truncated 8*' 1#x!%P)d+@ P@T8I ""@#!?$ L@"@S8$ L@L6 "aP@.+c@@S8@S L@$& #x@ P " P"Ȁ  "`c@. #x     $@S L@#x@ɐ#x0㿘8"#P"  P" @#u0@#Z_z-z-gz.tgz.taz.zzpQ  @ Lb "`@T $&В@@Ð@TyЪ@Tt@ $?L /%@@ %@ "`@  .Z㿘Q @TW#8 ?"c!#@X# ?P" 8#  #!#  #@\ P ("b@T,# @ `8 "`#%)P @C@a `,@ @6 @6%"  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘!#x@cP#xP" L .P"  PP" k P"Ѐ fP"Ā  PP" 2] P"Ȁ 2X P"Ȁ DPd"a0@,9P@@ hbȀ @ bbЀ 28,!X !X, `,  `,  `,  `+, "P"Ā  P" PP"Ȁ bd"a`@,Pb     "b"#d#x@㕒`  %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐P" P" #@# `"@ /#@  0#@# `"@ /#@ # `"@/P?"bc "c" @"#hc@   c@  P"#@# `"@Z $P"؀  d"c@+!PQԐ#"`t#@# `"@7  d"c@+P "b?d"’` @+P "bP" ?d"’`h@+q P "bP" ް?#@# `"@ #@ # * `"@ * #@ # * `"@ϐ * #@ # * `"@ *  P" "#X#@`"@ #@`"@ 0#@# `"@ #@ # * `"@{ * P"Ā  d"’`@*ԘC#@# `"@[ #@ # * `"@J * P"Ā  d"’`@*??!##c@`$#@+ ??#SP" 2!P" P" !# !1###@c `$#@ * #.@#x!-+#x'#c $#@ .*`    #@#Pb `2"b!%#@ʐ  #c `$## nP# g"`@#’a@Ĕ  !# #a@  2$#QԐ#"`t@ r?E’a@   Q!"`tP 8"b’a @   Qސ!"`tP ""'"#h’a(@   PQ!@"`tP "b" P" P"  P""Qې#X"`t"# "chP"؀ &# Pd"’a0@)P"""Ȁ  Pd"’aP@)Pb ? "bdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐Q` `P"`"Ā @W HP"Ȁ 3?@O h.?,?P"耢`P"쀢P"Ā   P"Ȁ  PPŐ b@0PP"`@" "@d@*@@" 0"#|##\`1$c#h -??@O;  #$c $c@Nw  @* * @*` * * @*` "|@ܸ#X * P"Ā  Qa.`Ő @ @ٔ!#Ő #@c|# PP""" @$c| $#耢`#@"|2 PP""" @"| "c쀢`#|@"#`@" |"@d@@Ő @cx` @`?8@O6 @?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?* @Ȓʒ@ *?name too shortcan't recover suffix .internal error in shorten_name㿘  @NP" @ؐ! ]*?J 2,@͐!0, "cd?@aX '" ",? `,? `,? `,? `;,'Ɛ@| /   @|H?L 2 L 2``  `,@*  `@U . 2L`@!PL` "@ޓ` %s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten 8"#1#x@  # ?2 W#x#xP" 1#x  F#x#x@  # )#@cx #P" !#d"ƒc0 d"ƒcX#x@'HTPP" >#7H!d"ƒc@'5x# d!@CsV   "@''c@Bw"H O@}OHe @  `Y dOH yd"@' cPb   @#x  d"aP@&@ސ#xP "b 㿐`'` '@^ݒ !<`  P"Ȁ  Pd"aP@&Pb P "bP"Ȁ @߮#x%s: time stamp restored 㿘P" #X`! P& "Ā  d"ǒc@@&x!#x #x@z o P"Ȁ  Pd"aP@&Pb P "bP"Ȁ @f#x#x @z P""@# P"Ȁ  Pd"aP@&ePb P "bP"Ȁ @@#%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@ d"Ȓ`@&6P :"b+P@U 2Ɛ@aH Ȑ@a @Lܐ@Lِ #d@ݒ  /, @Ւ0"a@% %b@N㿘Q!$ Q@Lܐ "a$!  "!P@I@$ !P"䀢 "!@I8$"!# "!@I0$#!#@ "!@I($#@!#x "!@I $#x!#t "!@I$#t!# @I$#@L㿘P" @Kf L@5#x 㿐 77"#8" L"HP "b#@ *@ "H H#@?* `@"H@KH#@ * `@"H@>#d 2 H#@* `@"H@-H#@#@cX `* ` H#@`2 * ` HH#@ #[* `@"H@ H#@#Z2 * `@"H@H#@#@X*@ ` H#@X2 *@ ` HH#@#X* `@"H@H#@#X2 * `@"H@ @rx"c@ hP@$bP"@"H#@* `@"H@H#@ * `@"H@#d @#3#!cHc@* &cH@N  1#H@"`@#H#@#@xc `* `&#H#@`2 * `&#HH#@x #* `@"H@aH#@x#2 * `@"H@RH#@#@x*@ ` H#@㐑2 *@ ` HH#@x#* `@"H@0H#@x#2 * `@"H@!H#@#@c `* ` H#@`2 * ` HH#@ #* `@"H@H#@#2 * `@"H@H#@#@*@ ` H#@㨑2 *@ ` HH#@#* `@"H@H#@#2 * `@"H@`@ @"`@ 㿘#8@Ik?  @Sx"cc"cbad pack level㿘? @}"x"##@ @J xQa,.  "@ "`"c "c@  @ 6@"#T"#!x#ct€@ $#?xx "#x$"#"#x#!x1x!x@#!# x"# #t#㘑*   "㘁㿘tTL tT!L` @7`t] X @S  `M ` ` @6'` @/'` @('` @!'` @'` @'` @ '` @@*ɲ`'!  >  D@ (@2㿘Qx!(c"#T$@%C?T?"@=#t!  @@HcD""cDT"$Tc""c #@#* @ @2 2  * ## *@ @3 3  * @x# #tcT xc € xx "cc"c㿘  "cLx#)x%T/#7-@'x3#*`Tt @ @%# 㐑* *`@ @22@# "@ Ґ 㠀8 6T#D"@@?㠐"$x#t?T$T#*  ` %# **  3 ?2TT $T t %#* @ ` %#tT @M 㠐?$T $Tc`t  Tc" @Ô T&c㠀! x# #x!xc!# 㠀 w##`#t  #Tc " @ 㿘 x#  Elx# `7x%T5#;/@)'x-㘓*`Tt @ @&㘐 c* *`@ @2 2@%#L#D x#L#@# "@#L 㠀@8` #LT#D"@@8 #L?@ = T" @㠐 #L" $㠒%#LtcT$T㘑*  ` &㘔 **  3  2#L? %#L  T 2$T@t  T" @  T#%`Tt@ @s  `& t T" @ T%T  T$T㠐?$㠀! x# !x1x##!# 㠀 T㘀` #T#t@ @8 #`#t  #Tc " @ 㿘"#P"#"""b|" Ɩ  !Q! "*# (6 Q!  *@+@   *"*   !Q! #*# (6 Q!  *@+@   *#:!Q! #**#  ?( Q! ? *@+@  * |#,*```2 {! |#,.  2  `  2` !{! |#,.  2  `  2`!!{! |#,.  2  ` !2`!{! |#,.  2  ` !2`{!@"! |" . 2 @ْ   6@@ x(2 {(2 |(2y 0  | x""t((㿘|L.`.`@:|@|LH) .(@/ .@.*  .@@..@. |.`@@ .`.@'@.`@Ӏ|L.` 㿐 '     |#,.   2@|cL D*@* <;2 |#,75,|#L,  *   , `2 .   7  $* , @;Aℐ  &ℐ @;7@ &<Α,`C|#,-.   . |#,?. @ "?.  ?2  *`  2  ?`2 !|#,|#L%.  "?,@ *  `&@:  $4`?. x  |#,**`@  *` 3 أ,   *  4 * 2 @ 6 , 㿘  ? " @"= "`D|#L H, @  `@ "`@* #*, @2   ,  @ 4)& |#L  H @ # @*  " "@@* 4@ (ℐ?"ℐ  " " @  @&  @2  :   |? |#L/- H @*`% %@  D%D* %%D*`% ,, *@@  4@ @ @ @ @  -@, @*@ 2`2 % _ @ 4 |L`D?"`D* "1㿘?      +? <0|.  "- .@0@ .@0@`@ 0`@ 4`H`D0`D0`H         ˴㿘?   @    I|"-   ";  ,@@+?2   ,@`? @@ B?  4 H D@ F? @  J? @ @       㿘Qx#VbQ{ QbQ" |"Q# @*    ? 4 @ℒ` * @"℁㿘>@ɒ @ƒ @Ò  x|"Q# @*  @  & @x#c?{ _block vanished㿘bt"| "*@ #P?#@2Q@YQJ"QG"" 2" 2b@ "b `  @p ` ,  "@  0( @^ {!|@Œb b@Q Q"Qb `~`x#{@` b " @b "b"6 㿘tc*@   "tx#.` `:2 ?x" a*`  2 {  # c> ! @*{  # c> ! @*  3 x#x*`2`"x b * b* +b"t Pt"| * #"|*‐ +bP"܀ &"t/2#* #Tc" { Q!. @  @82`  @"t2 bx@6`4@  "t#@ "x @ 㿘 "tI"t"Q!!#Q!􀌠@ # ,`'`*`d@ld`"@e$@#x-`@`` 4`! *`@@@T``!$@@K"t ǧ4$@C$-l used on binary file x( x(@ x(P2``?0 0? ʄ 㬁㿘 "b@D. b@3bH#b@ *@   H@b2 *@   HH#@ "* `@"H@ !H#@"2 * `@"H@ . 2 ⠐" :3"@ "". ✐ 2✒@ #" 0`* 2 㿘" ,H#@#@ *@ ` H#@✑2 *@ `* HH#@ "* `@"H@H#@" 2 " H#@ "* `@"H@2"""㿘X#H# c@* ##Hc@6`*@ ##HH#@* `@"H@H#@6`* `@"H@xcH# @>`*@  #cH@2 *@  #cHH#@>`* `@"H@YH#@>`2 * `@"H@K5#!Hc@*  &H@:H %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘#㤘 "#8  *   * @`  "# *   * @*` Ґ#Pd"$`P ` ""؀`d"`    "`Q 2  "c,Q "c( d"Ԓa@P "bout of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈 "#8" L@Q#(Q#,P#  * @  * @*`@  *   * @*` P"؀ Q@  n"nj"#( dP"؀ a#  *   * @*`  *   * @*`   @ # ` `*  ` `* *d"ԒbД@! @А"  ?%-+3)' @c `$@ cH#t* `@&cH@ ?@QԐ#@Q#( )Q !3%#c@ `$#@v ,@  $#* @* @*`@ * ,#, - !3%#c@ `$#@K ,@  $#* @* @*`@ * * @*` #@@  @@C#8#|@<#`Q#( F# #@?#  *   * @*` Ґ#P2/QP" P"Ȁ  Pd"Ԓc@[Pb 2Q "bd"Ԓc@JP "bQQ"#("c, QQ"#("c, 8'H'L'P'T\ @? DH*`  "  H 2'@$  , @   , * ,`@ ,`8$  *, @@   .`,`@@,` @ @"@  ' "@ `   ,  *`#`" `H@ * '? 'h@' h-`@@N '%@."-`@`@"  *.@:*    @h c< #c<'@",& " / /'&4@* , "@ @ "`@ 4%@/H+`   c/L    / " * T@ /L" * P@7 %@4@ ., "  " .@@4 @@. @ , @" &*? @, 2_`@X-` @ @ 㿘 ?@:X  ? 㿐'D'H'L#p#l#HR p. '/` '-1/R p95 #@ *`%@j *L  * D  ' cv? `$4#@ *`%@E * ,  * ` ݢ `4 $#t `*@ L@j"H :`#@ *`%@ * `,  @$4#@ *`%@ *  * H  ) c2 `v $?4#@ *`%@ϐ * ,  * ` ۢ `$4#@ *`%@ * `%,  $@4$# @@&& % %@#t@@;Œ@ @#t @*@`? `@"H `ݢ @L"#H"#p"#l 㿘#p#l#H & 4#)'c#@ *`$c@O *  c?# ? 4 '+)c@# *`$@1 *  ?#*@4 5 *?'+)c@# *`$@ *  #t* 24 @@"#H 4 ?"#H"#p"#l  x .   "@  !x .   "@! !x .  !"@!  x .  !"@ 'tt#\x! !Q|Q#p )x  .   "@ 'll#\x  QR 4Ӛh pp0 htl  ph  incomplete literal tree incomplete distance tree 㺐#p#l` !)'##@ *`$#@f *``# `4!)'##@ *`$#@I *``# `4!)'##@ *`$#@, *``# 4HE ' )-+@c *`%#@  *``#Q#0,  *` " 4    Q#0, *   "@ '#\      0  R`p*  @)3/c@ *`%#@ *`@ # *  ' 4$@  . %@|  , ` #c@ *`%#@ *``#  4??X. %@?? P;``8 #c@ *`%#@a *``#  4|?%@ ??. % c@ *`%#@= *``#  4X?%@ ??.   r"#p"#lR '#\!Q|Q#@  4d"@obp0R '.#\ QR 4&  d"@UbPN0S   CA  㿘#p#l  `%)'#@ *@`$@ *@  `&? 4`%)'#@ *@`$@ *@   `4`?"#p`"#l``  㿐"#H"#l"#p !$#< "#<8 "$#<#l  l"l?`"@cH 㿘8"## !%##@c|# $c|@8' $##? 8# @}c|"# R?`R (0 R 8 H  | 㨝㿘"#8"#)'!% ###8@ @7ޔ$ ` #@$## 2 ?@0c " "c# 㿘!#H  L@%c@|#H "|$#H㿘#cH`!#tP"Ѐ  L#t@ cH|H "|"H㿘@7s?&@@JeJ@ @ @*@`J@㿘@_ / 2 㿘@V .  @"` _J@ ."*@@ out of memoryargc<=0㿘@ @5^ @8o@ @wN ܠ#0@gN @fN .N 2@@45 $@ @w  2@@0#8@&@@(#H@$` 3ܐ@0c0$ N $` 2@$ %s: %s: %s 㿘d"ݒ`@E%s: %s: warning: %s%s 㿘P"Ȁ  d"ݒaH@*Pb  "b %s: %s: unexpected end of file 㿘d"ݒa@8# @#0d"ݒa@P㿘d"ݒa@@ܐ#xA%2ld.%1ld%%㿘`1  @4 . "* * @.2#@.. ?`&@ - -* &@+ ?`&@  * &@@. @ ݒb@㿘@3͐ J#8output in compress .Z format not supported 㿘S  S " d"@~cP""  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿈'D'HP"#@# `"Ґ $SP"Ԑ ```"P"Ȁ  Pd"ޒ`h@$Pb 2P "bPbԘ "bԠ , 'd"ޒ`@  P""E#' !'? #* S !!# @6Ô! ct*?ct;<"  6  *   ? D@ @5N ?' c"c쀠@G$,  @6!!- ?@$? !'*  "3@- ?@˒$? P"Ԁ (? (?'<@ @ * @ * @ :@ @  c@*!S x?#(@PЀ  PHc@:c|&c|P" ސ ,@ t ,@, @ t ,@?@x" +5&4 c@@4ޔPЀ 2  Hc@c|&c| @?@x" ܐ& c@@4@6 -`2 t*`F@쀠<P"Ѐ   Hc@c|"c| 㿘`đ*2` ̀('! %+) `̰& ȓ*@Đ 4c@# `$2 % Ȁ?"$ Ȑ $`̀`̐""`ȓ2@Đ 2ā㿘`Ē "@> 㿘2 " "  Bad table  Б+```2@ @ @ *`  `@ 2 7 О `*+` # *@   `0     @" +`:@2& + `@2`   +`# *``2 * @;@`  *@ +``@ 6 "  >*@ %@@2(  @((+``@ 6!((3*   #(`@2 22`* * # + 2(4*@㿘F  A  "* &* "đ,   2@0=+'"đ* 2 ` 2 @đ2  `` ,    ? , Ā "* &*b  ā㿘    c@*`ac@ #x,``o2@0R@Aa")-+@' đ2 *     ,   2`"x  @        ? @@*?`@?*@`@ Āa c@*`ac@!c@ x㿘1" z  &"-!  *   $?b?"b đ2 cx* @!  #@ .   !2`#@ 㿘b đ2 * @   #@ .    2`"  ?% *@㿘'""㿘" " ԁ㿘 `А?"`#@.@   9"`А? "`s!  +"`#.@ $0?$`!&??* $"`А? $`В#b@.@b   "b`А? $`0ρ㿘"#8" L Ԁ #P1!#tbЀ   Ԁ #t Ԁ  invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘" آ  %)'ء* #@ `$ ``%@ #@# `"u $ ܀ !Ȥ  ܀ "H'/-+㔀@, `$T %,@`܀㤀a`" ܒbH*@  "@   ) !"H +-,&@`$)c@ # `%c `- ܀, ܔH*`  "  ܀@H: *`# "`܀ 4  (c@ @H*`# (*2`@*`@*@invalid compressed data--length error㿘"#8" L#"# "# #*@?bH ܑ* @?5'#%-+c @!* c $ %c `$c #@c "@ 2 #@ `",0`,  c c * @c `$T %c  $c c "@2 ".` *۲` ܀@cH#t!.`  +  #cHjc "$c d c|2!  J J   (8  J  0(S( " *c0* S4 "c0( " *0(S 4( " *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘'DS" Sༀ $ ""c4"0"#(N - + "c,"#, @-!耢 "#, "c,#( "J #, 0!S#0c4  S @ SS#4` "#0S "D  * @J@ -J` S`"#4!S D (* @@Вa "S  $ #0c4 @  0#4@S "0D"#4S" SD  S#0c42"? * @J@ -J` #, S?S* @ "ฐ " S #(S *   @ J  -`? @  " S * @J@ -!J` -`#(#(  @ `= `L@  @ )#( @/`$@ 2#($@D2  S  S *d"b@@@ !"#(#( $#(wS `" L@ 3 S`W"`S S * ?J  - Sd"b @@u! * ?d"bP@J@g!#(#( $#(  *!SD  SS*@"`"  S *d"b@@@!#(#( $#(N :  :!#(#( $#('`  "@ ` * @J  - #(J@ /!S S * @J  - Sd"b@@( * @d"b@J@#(""c(S` "`k !#(  $#(. m:`#(J S` "` :2JS  . d"b@@×:S. : "`B :2>. J : #(J@  S0" #(J@ S" S` %"`S D SS  d. "c@@:S. :`" N :    :S* @ "ฐ ""#(. > 㿘   㿘 /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐 @j` f  -$@^ X@ً # 2,@\``@-Ô  !  @\ L 0 `@]~ ` a   @\  `   @ @w @\} @& @\q @G/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@-@"@; .@[2`  8#  bД@@Z <8# 8 b@$,@  - c@0!+@#@筐  @ @c @%0@vndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@m  `l!@h < @@ `0"@N$/@, $@ @,?@u @@,? a ,@`:!@*T @4  8# `@,o?,@@% `!@6 !@/ e`e@+1  `"@@+G @+C. :  4  `"(@ SaP. :  4* @J@   %sr%s%c/dev/%sr%s㿘&@֒ 58# 1 L@ /,@! a P!@ P@ 8#  ! P@+?,@ P& 8# L@ /! P!@Ԙ P@ P&$Id: logwtmp.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/log/wtmp"X @l "@"p А@S ؒ@O @K @̴@*D $ $@@*$Id: logout.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/run/utmpp#P @- *  А@*. $ $O؀ @+9  @d @a @m??@*Ζ @) $ް @*D$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@W`a@*  ??@ђ @Β @˒  $ @* 㿈 ' ' '  @+i ?㿈 ' ' '  @+U ?㿘 meN`  e , * N ?а N  , , * N . * Ne @  e?Р N @ ` " N N  2 N *2 @  *` ƀ: N  8 * 2  Sb*: @* : 2 @: @!$ 18ƀN!X? OOPS㿘!P 1#H*!N` !#/8!`%Nۀ M *  p p p p p p p p p p h 8 p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p $ p p p p p p p p  p p p ``%`` `c@  d 0,@v d@   0,y@h  0, "SQN@ N@I N@ ``` )8T !@)Đ  M!\`"#P0T@ߐ`` :?1,ʦ ``:41,@ : , @  `` ?$@* $@N`* !P$#@)a >81@aTERMCAPTERMPATHHOME.termcap /usr/share/misc/termcapx"!@&#P L /"@&#X @&x#h  @#,#@)J@ /,@`$@ #cp" 6#@`/$ @ )*`:   :2`,@` @ *`:   :2L@`L@  @L@  $ Т`L@  @$L  /" 't@zƐ 6't0?'ttx@{ t t@Ԙ#-#@ : ?L 2,?  t  t"a ?@%h? ?㿐!@~ ?㿘!@z :@ 㿈/ //!@}찒 &  @@ @ &@㿘S#   !S#  $# ?#  # 㿘8 0 0   8 0``*  2`` 8 0, @?, @ "㿘a  "a *:  :: 2@    &  @      㿘  ?   b    =   b   S @ & F` @  & & `@ & :`  @   € @` €  ` : @ & F` @  & & `@ & :`y t ?#@? ?#@   h2@   @2   W U " . 2 * 6. 6.    @ @` @  `@ =` : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82         b 㿐T@? )@  0?@ `㿐?TT  0jBT TD' …B' @      . @I ` 6`@ 6  @ @>@T?&'T TD' …B'   @ f0TTF' …B'   @ F: #ddTЁ B B#dd`T؉BD# * 22 2@   㿐  ?   b       b   W & F`  & & `& : 8 @Ē    @`  ` :  & F`  & & `& :  ?#@? ?#@   2@   @2   fb_" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ @@ b f. 6 @6 <   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘S @ & F` @  & & `@ & :`  @\   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`y t ?#@? ?#@  "2@   @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     $OpenBSD: setlogin.S,v 1.2 1996/08/19 08:18:11 tholo Exp $ 2 c<@8 `㿐' `v@"y㿐`w@"p ?" ( " $ " "  g"  ?"  ( $$OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@ `*@`: DJ  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $  ( + 8: " ( "$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘@Q[a$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< 1 b(+ c" ?$*@ ?*@ l0  ?*@ 8  ? *@  d - s p w*@` r -*@` w -*@@@` 0 @ 0  - x S s*@`  r -*@` w -*@`0  0  - x S s*@` r -*@` w -*@ `"   *@ "   *@ - x T t*@` *@*`$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@پ$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/sh㿀!'!'' '5 '@M@O'?  @M$?@M8!@ydx@" @ H  @ D @f @Mr @ 9 @ 6??$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘e @  ` - + L@@ L@` 0 L@ x XL`` ? 0  ?@Y?@9 )e/8     ?А   ?ɐ?8?  ? "%〤 @r @آ`4 `&@$OpenBSD: realpath.c,v 1.3 1997/06/20 20:37:45 deraadt Exp $./8 ! @Ò@ . . @̩#.#@x / @`  @(*`J@ /"*`@N e8@勒 '< ( 2`` 8 >M"c@$ &G8.<   @NU :8!@@q$ /8N / N `?O @ @  $8 ?"c`@`@@M 8 #@|0 8#@M@u8"# $OpenBSD: rand.c,v 1.2 1996/08/19 08:33:44 tholo Exp $㿘!Tq#@bm `9 $#1 *T $OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $㿘`8 "c?@ 6`?&-`8*@a  @R $ ,- ,ܐԪh`@4 @,` @) @,`  " @  @  @,` ,4: @@   @,`  ` @,` ڦ`@/ $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘8   8T#J )88" T# T* @"cJ -T#@"c?J` `"J` -2 8T#`"##@"r?8TcJ" :"c@’ 2!J 8  -T\?#J TTc "cT# N ?N :J(8d"/cH : 8"#T#J 983TT#J@ 8&"#Tc "cTc@"#N :T  :#  (8d"ch8@ ?8T#* @"cT#@"cTc "c8 $OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘>@@  $>>> $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @Ԕ $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘8ct2" $@ߐ 2" ?8ct""ct*`" `" 㿘d"@@㿘 @? @:㿘  @2  x@=''`@' ' '' 'd"@@耢  ?㿘'L'P'T'X@yL㿘` ` 2 `@{ 8 "c?`?` &``@ . :  " @* &@ @㿘`? "`@  "@@ؐ $OpenBSD: auth_unix.c,v 1.9 1997/11/08 20:51:23 deraadt Exp $authunix_create: out of memory Р@0 ( Jd@+! DU!& & $8##$` `$``$`` & `& `& $`H@u H''''''0P!@͢ @ 24@ @0$` $@@ $`P@@&`& `& @͐0d"@b @ ?  @t/@J @J    x*  #@ x㿘 $ ` 㿀@ ' $``@=   "@$ @ "  & &   '@ $ & &  & @g `$ @2 8  $ ''  @ @ @Ē '' € @ "  $ $ $@2 '@֒ `@㿘 $@b   @\@Z $  @T@Rauth_none.c - Fatal marshalling problem㿀 $`!@̰ @g  @a 2 @"p  @$a  `@`     $ @ @@r@: <  ! ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@"`  @㿘+>/;#-$ .@ @@" $@"  ,@  ,@ $ ` , 2  .@ @"Ͷ @"ǰ @"¶ @&@@;@]@"@@@"@ @+@$@ a[@@@  5@@ .@ @И" .@ .@  .@  *  &: :  .@  *  &: :&㿘  >' % #e $` .@ @"6@"A @ @ך @L @ @Κ @"@"ǶĚ &@P(@"}  , N@: @` ` * `@ @  ` @2   " @: N 2   |  @  " @:p N@ 2l   ue  @2    @:  N 2   2  @(M N@  2G `_"D  @:@ N@@  H`_F`5 @2   "  @:  N@ 2   2  @: N@@  2 `_"  @( N@  `_`  .@  .@  ``2@  .@> @W@"a @>0@"^ 0@>@>0@f0, , @`?2 ` ?"  ,    $&@8      @ 2  . @   . 2@ 2>, /` " `/` @> " , & y 2at>,!>9$#%"c 2K .@ ' .@ .@ ", ,   &@: : 9 2! , :@ , ,  &@: :  " ,  :  㿘 @ N * @<   )e @ N@@"   2        ,    `    `    0 "` ` @? `    _    2 _    `_{`     {_  {  @3@  @  @u`& 3@  `㿘 0 @ N * @  )e @ N@   2        ,    `    `    0 "` ` @V? `    _    2 _    `_{`     {_  {  @3@ 2@ @  @u`㿘 ى(>'% #!$`. @"~%@"h @I(@J@N?~@ @V@@@ m@ (@^@ꀠ@@   @Z"@p&@(@ v82rm   2kf e b( 2a\ 2]X 4YT (` Q `J G((10>; &7((0((*(( `(  5>`3$@(@2((`( ((5) `     $ @ @@@@: <   ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@` @@`$ 㿘+>/;#-$ .@ @@" $@"  ,@  ,@ $ ` , 2  .@ @"Ͷ @"ǰ @"¶ @&@@;@]@"@@@"@ @J@C@8 a[@.@'@  5@@ .@ @" .@ .@  .@  *  &: :  .@  *  &: :&㿘  >' % #e $` .@ @"6@"A @ @ך @L @ @Κ @"@"ǶĚ &@P(@"}  , N@: @` ` * `@ @  ` @2   " @: N 2   |  @  " @:p N@ 2l   ue  @2    @:  N 2   2  @(M N@  2G `_"D  @:@ N@@  H`_F`5 @2   "  @:  N@ 2   2  @: N@@  2 `_"  @( N@  `_`  .@  .@  ``2@  .@> @W@"a @>0@"^ 0@>@>0@f0, , @`?2 ` ?"  ,    $&@8      @ج 2  . @   . 2@ 2>, /` " `/` @> " , & y 2at>,!>9$#%"c 2K .@ ' .@ .@ ", ,   &@: : 9 2! , :@ , ,  &@: :  " ,  :  㿘 ( , 0 @ N @# ,@ @k@ +e @ N@@ "   2        ,             0 "@?  `  _  `  2 _ `  _{  `  { _  {  @ߚL@ @@@{@Țd`& L@  `㿘 ( 4 0 @ N @] ,@ @ +e @ N@   2        ,             0 "@f?  `  _  `  2 _ `  _{  `  { _  {  @&L@ 2@֣ @@@@d`㿘>%' #!$`.@ @%"q I.`LR?~ɶ @ a@@w@ @"o ꀠ @  i"~@&(" 82@   2@x w@r  2r@k 2l@e 4f@_ (` \ `U@P  @. @ @@O@@`E/@("B&= @. @@@@2/@O@. `(@ 5> $@(@@@ @. @`( "@@@/@@@(`㿘<"e@  @4"E@2 `( "`    "   /*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@3 U"X"X  !@ !` @  !"`@ @`@b`@ @4*?0%d㿘U"X"X " @0  "  2 @jcH1#@0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @ @ !S 4u *`  $`@ * $` $`@ #g $`$@$`$`$` *`@" `` " H!$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @ {!$ H@ Ӕ `?$ @:  @l @ @  `?$ $@ s@ @ &@ $ L4"E$ D& & <"e& ( @ ` "`@<|`㿘  @  @* :  |" :`" @H @:  @ |*  2@В  @&J@ |!` & "@ v   @ T" @ " "@ I   @ " $@ ;"㿘   &?ܑ* : `X  "t*`  ) * * * ' * )H )H * * )\ * * * * * * * * * * * * * * * * )H * * * * * * * * * * * * * * * * * * * * * * * * * * * ) ) * ( * * * * * * * * * * * * * * * * * * * * * * * * * * * * ) )4 @ @(   D`" D  D ,  " @ @J@ ) ) ,  " H@ J`)]&@ Y@  `( "`( `, "`,J @  `( "`( `0 ="`0@Ւ 9@В 4   @ + @a &@" @ @   & @: , J@e`  @ , @:` @  @?֐ , :  ? {ѐ` J`e`   &@y , :  +"%  ? *"  ) {G"@ @" "@  "@ @"k "@  @ה" @""@Δ  @ $@Ŕ K@$ @J@ ,`&J`e`   !@@ @Y @ J@ }2 `&@   J@ }`&  @ @ߒ @ܒ  @  @?֐ , :  ? {`  J`e`  @ 㿘 @ @  @   J &@Ȑ   㿘   @ J@ ^ @&@. `("`( `,"`,  @ @  `  J@J` `@!   ` ?& @  `( "`( `0 "`0 @R 㿘 J@``\ & @ @B  a &a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0|  @\x @ s@Fo@  k  D`" D  D ,  " @ @ `  J@ \J` ) \D ) ,  " H@w @ ` J@ \ J` )`(&@’ $, `H @V` `@<`H@M @    "`H@ @ ~ @:"J@ *2`& "@F @'" "@: @"z  @ r` p`$J@ \l`$J` {h`$`&@i J ,& @eJ`   !@P@H !@ @ `  J@ \ J` }2 `,&  @ @  ` : J@ \2J` }"  &   @ @  @  `$  㿘 @`@! J@e @ `  `䀦 . * ?Д J #@ J     @В [:<:]][:>:]]㿘@А @   a`@ 2& @  ah@  2 (@C  & @: J@ ^2`& @:J@ ]2 `&@ ] ` *] ` ] @:J@ -2 `&@ - ` *- ` -,`  "J ]"     J -J ]"@ @ : J@ ]  @:J@ -2 `&@ - ` *- ` -,` J`]&@*   t ` ,`?,"` %e @ `   "?@* :  @ ` * ` ,`? ` @/  ?,  @ ` *@* `" ` * ` ?,`   " ` @ ` *@* `?,`` @@  @@ސ@80@V@S 㿘 @ J@ - [2  @  @ 0* :  : ="40e &  @ J - ]@ @ @ @u  @  `  J@ :J` ]3`@b 0p &  @Y J - ]@O @ @ @E  @ ` J@ = J` ]`B&@/ 0=@  J -@ :,`J ] @ &J -& -@,`, @@ ,`, @:`: @ ` * `   .`㿘 e  J@  `& "U#d#d @@ؔ 2` @J "@` @ @ 2`@ 0 @ ` * `.` L   `@@Ԑ L 㿘@L = @ `@ * ` .`㿘 @ @  @ ` :J@ [2 J` .2`$J $@ . @ ` J@ . J` ]`$@V . > 㿘 @   : J2J ]"  &   @  "V   @@) 2`@J "N``@   @ 0L@e` e_* : * H㿐 && / ]//&& 㿘  8  e @   ɐ* : ے0@f`   `4, "`4㿐 &&  ^/ / ]//&& 㿘     .2``@`"h*`  B B B B Dx Dx Dx Dx Dx D C\ C Dx Dx Dx Dx Dx Dx D( DP$ " p&  "@$`   @" @B""@  @9 $@ 0K "@  @" @#""@ؔ  @ $@ϔ `@   "@ږ @"0@l0@b0@  "" 8""  㿘   "    M & 4 @L   2 @|,   @,  "`   2 @n "` @  "`  ,   @ :``  $ ` "  ``%@  @    - @  @:`  &   %  * . . & &  ` (    (*   *` 㿘`  *` @  (  2    @` @ @ @ @   *   &@>    @ ` @" * :      @ ` @2  㿘``@'&`` @&` @`&` ` @ 0?@``  *?  8 `         ` 8 `          㿘  (`8? @ 2   " `4 &`4  ,@ @ 2  ǔ 2,@  $ @  $ @㿘  @c   * .` @. & 㿘      `2`@:`*`@E   *`@" `& 㿘  ' ߐ ,  *`  "` *`H "`H *.   "  @E* "    (@> "@㿘   @.` 2&  0& 㿘 &`  @ۓ*` &`  &`㿘  u ` >1)'%##$" @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@1  &`<&`@ &`(`<`@`> @  @ *`*    ! `>     4  2 `("`(%x.0.%x%02x㿐   7 7!#Hcp@d@@#H    @` @ @@2 @-  @Kcx `@Dc@1L 2  @`@8#@*L@- 2 @*c@ 1#H  M υ(85@( Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q *   J` H* *`@@j 1/@K #  #@D .@@ :  *  . : . '. p#|#|4p`4 `4 `4 `4 ` 4 @I  2p4@ 4` 4` 4` 4` @  * cz@0 ct@+ #p#p4@`4``4``4``4`` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx N -#\c@/Ԛ#!#\#`c@/!ϔ#\#``@/!` @/@! @ h!̔ 0ӑ* :  KY`*  W W W W W W W W W W W V V W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W  ,@  ,@L@  @  0+` N 0 8" @#N  L@ `" 4 @  ,?ܐ @.,@?@.!@㿘`  @m, `4  @Ò&@墒/ /&/㿘`@@  `@ .`"А  ?*`: &? *`: ? *`: ?N   2    8  % ,  Z< Zt Z` Zh Z Z Z Z ZL Z Z Z Z<?,@` ".`,@`  ,  ,@` ,@`@*` @$@$@.`.@㿘#  @   @    :,@V .#",   @` ` ` , :` ,  , @ 뀤,1#㿘#ɨ  ?@c  А *`: ? *`: ? *`: ?N 2``` ,` \ \ \ \ \ \ \,   ,  , , *#Ȓ $ *#ȁݔ   *` .W *@ ` *`8 *@` *@` * *@#%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈*` *   *     #\ #` #d *`  #h1W pa@Ȕ  p`@@f 1/@G #  #@@ .@< :  *  . : . '.   , ,, `,  `,  `,  `,  `,  `,  `,  `,  ` , ` , ` , @a  2 ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` * @ * `*@< `$@7  ,@ `,` `,` `,` `,` `,` `,` `,` `,` ` ,` ` ,` ` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx N -#\`@,#!#\#``@,!ϔ#\#``@,!`@,u@! @ h"l 0ӑ* :  KY`*  c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c  ,@  ,@L@  @  +` N 0 " #N  L@ `" 4 @ђ  ,?ܐ @+Д,@?@+ǔ!@㿘`  @E, `4  @&@z/ /&/ * ?*@?*  @ ?*  ` `? *@0 @  `?# @㿘8@,#l@, @m `  @c   0耦` 8 @U 8#l @,㿘8@-. (@-P 8@< 8  @1   08 ( @-!㼘'L  ?c   Ժ$`  $8 @ ` H" H" 8# @8 O耢 2 b@  L ' f4   b2 @s$/  @[$ & W     @  Ƞ  $L 㿘8@+#h@,  8@? 8  @4   08#h @+㿘8@+#h@+  8  8#h @+LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@  !" 2 @U  $""J   ("b ׀`   ԑ. 1W#Ӱ W#,`@@@``$,`N@ J W#. @' WJ@ `W@# J@ `@ @ J@ .  H.  ؠ@  z,  W#' ؑ,`@@ "J@ ,`ء,`@s ``, ^  .  ؠ@d R, @D /   ء,`@T ``, ? L /"L O ؐ$  ,``@:,`,`N@ /"`  `/"N@L  N@ ސ$` ,`  @s`  @Q @L 2  2` ``  @ %s/%s/%s/%s/%s㿐!W@Ec< W#<W#)+W#W#. @@  !#\#` `8 @@  `1  . 1!POSIX%s/%s/%s㻘,` Wc @ 0,``ؠ @`H @`  ,`1W#@ؐ@@ 0,` Wc,`$⠘ @@` `㿘  x |1X( င&! XX .` `(>`@``?/@  X . .  ..  (`(@@ ``?*?    X@ @./.?$@ X  /..@7$  X./$   * * X.&&& & X  @ 4(@@'@(@' 4(@#(@!``$ LJ. * Ö* X. & & ` @  စ(@'@('```.dž&ˆ& !` @@ @ ᄅ(@'@('```.  Z XX.$ XX . X. ' .  @@ (&``$ @.  $ X  㠁| | x    x@"x*2`㿘  H 1#7`*`7` # 7` `/`@6`/  6` 6` `.`@  $@@l@ @ @ @@@ ??`@)>'~~  x`(@0 @0 @ 0 @ 0@ . @ (a(`(@ 0@ @0 @.`(@6 (@/ (@@??1#1 *`1  # 1   /`@0`/  0` 0` `.`@ %@1# $@l   @@ % 㿈X# }/ / / / / / / /''.@.`.`.`.`.`.`.`㿘X# 2H   ## "#"# c0,`0 ! @"0  $@( &@2( (@2 a@ *@2 ! ,@*  n@Òc @"   @ j ,  X  " "Ǩ#""Hˈ#@@(@'0@ .6  &,`,2 !2 "@2$@ *&@2(@2 a@*@2 !,@ *.@$&@@@@@j@,@@$% 㿐 X#+     @  + $$+ , 㿐X# pӐ  X#+ #@  *@ @#@ $  + ` ? X# + +  *  @ ,    㿘   1Y &" ϺY .` `(>`@``?/@  Аψմ . .  ..  (`(@@ ``?*?    ижHXϰ% @./.?$@ ϸeY(϶%ϲ /..@7$ ϰYp./$ Ϣ * * Y@Ж.&&& & YДH  @ 4(@@'@(@' 4(@#(@!``$ LJ. * * Y@ϔ%. & & Є` @  (@'@('```. ㈆&㈄& !Є` @@ @ (@'@('```.  Z аY.$ Y@Y . ОՅ. ' .  @@ (&``$ @.  $ Y  H     @"*2`㿘Y#H 2~   ##"#"#c0,`0 ! @"0  $@( &@2( (@2 a@ *@2 ! ,@*  n@c @"   @ j ,  Y ` ж# в" #Ю#HЬ"#@@(@'0@ .6  &,`,2 !2 "@2$@ *&@2(@2 a@*@2 !,@ *.@$&@@@@@j@,@@$% 㿘  ФȠ ФТH1#7`*`7` # 7` `/`@6`/  6` 6` `.`@ ㈐ $@@l@ @ @ @@@ ??`@)>'~~  к`(@0 @0 @ 0 @ 0@ . @ (a(`(@ 0@ @0 @.`(@6 (@/ (@@??1#1 *`1  # 1   /`@0`/  0` 0` `.`@ %@1# $@l   @@ % 㿈Y#H #/ / / / / / / /''.@.`.`.`.`.`.`.`㿈N@ $YN` 1@4B@+!>#H 2| * *  " ( 2& N@ _   N@ z@ *`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڤ  N@ z@ *`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڢ@N #!Ϡ B   N  *` @*"  q 2 N !ϐ#@ #, @SN` z`*`:  `?ő*`:  Z *`:  @?ˑ*`:  9$*` :  - ?@N@ z *`:  `$*`?ő:  Z *`:  @$*` ?ˑ:  9 *`: `- ң*@@*##N` `  #*Ϡ# Ø 2C 2`YP2` , 2` ? , 2` `? ,  ? , * 2 ? , 2 ? , 2 ? ,  ? , * 2 ? , 2 ? ,  ? ,, 1# $OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @a$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@@6 0`㿈`2@ '`'''@/var/run/dev.db@h @ 29 <  &0 "X   @w #P @ 7P'T'X '\` X` 2 ``Za}@d`@1Z!x@@/dev/8&@# & @͐ 2@ `@!Z!} @լ?@ @@`@@ِH @Z E* , , # @˒c&* , , @c& ?@> )* , , # @䯒c& * , , @䤒c& @ؒ 2?* . . @䓒c? I @*`2`Jg" 8o-"M XO+"KL* D`H*  u2D*  !00    ** **  *  +  +  "   *"* 2 㿐M@ P?' @@Ґ ,`@Α2 <` @  @ B ,?M@e`  0 @ * 2 $` @  А `M@  @ @, $ ?@ ,` =/@3 0 @А (!@,` M@ g"d8 o a" m @ u"i @``M@ +` - =`=" } *`> @?* :  *   h h h h h h h h h h h h h h h h h h h h h h h h  $`"Ъ``"ɪ`b II @z, $ ?@ ,?>@6` =" + @Z, j$ ?@ ,? X@g6`  @B, R$ ?@ ,?M@>@O6`>= ="  @, /$ ?@ ,?>@,6` @, $ ?@ ,? X@6`0`M@  ,2 @`,@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *   - +  X@2`2 `7 J@+-X   J@-+`8  X`8  `( `** 2   ** 2  "J@** 2 ͐ longjmp botch. 㿘 )b@< 㿘@@]%u㿘 `?* c  !N  2" !# @7(  $#@5 2&` 1# )0@^# @@ .  㿘 `?* c  !N  2" !# @   $#@ א 2&` 1# )0@-# @@Ԕ .  /bin/shsh-c㿈'D'HN@ r w8HK` 8 "cg @y '` @Ԑ @?` H;K@@@@I # " K@ @R  2 HK@ r @ "*@B|  @ "*@Br @* *`*D@A @뎐  r2@d @_H@#`#`c#@"c㿐@E #    2  %8? @/ɔ ? " `"c$@@???c  @ ??˰?#@  °??@ ?# @! ?E??#@!=?#@?@ ?# @! ?0??#@!(?#@?@ ?# @!  ???#@! ?#@?@?# @?#@ t??c@I ?c     ?@?# @?#@! ?#@?@ ?# @  ?i#?#@ a??#`?@ ?# @!  ?G?#@@ ! =?#@? ?c @ ̀@?.?#@@@@ ̀@"?#@? ?c @! @"?#@@@@! @# #? @@ @ @[ #`?@ ?# @!  ?H ?#@@ ! >?#@? ?c @ ̀@?/ ?#@@@@ ̀@#?#@? ?c @! @" ?#@@@@! @2    ?#  D?#0@ b 8 "cr??# ,% #\    @ja? J  , , 4 $    @] ? Ѐ =?3  @琔/%)@"" ` 2J@ "@q 2 `$  `, `4  `? ,   2􀤠ۢ` ˀ@eSF ӄF @   "  ?b   @???#Ȣ@@$ 4 4۰?Ɛ !?ch@ߘ@ ?#Ȓ@`.@݂`0?#Ȕ #\  @竘 ?```*` *   ?#Ȑ ( ?#Ȑ (* * `  * @ #\  @yа J  , , 4 $    l   @i ?  ^?\?3@?#Ȫ@@旔K%E@`"> "9 J@ "3`  `@p 2" `$  `  "       ` ,  ,  ` 2  24  , 4 ? ,   2` @P㿘 [ ,, @€?  (, 㿘 @& ?@`㿘!8$# @ #  ?@۔e  e     e  e  e  e  eJ  e  e  e  e  D (   ? 㷐`"@`"`"`~"` "`"`@   `  2    \2 2   \? 2 *`2@0@㿐 {   }  @w { @ @ 㷐@@2@`@`   )`[2  ] `" `]` "  {2` }2 ` `܀`[`  @T&@O@ [" { ,#`A` }`;``@ ] `"@`@`]`@ ") (`%``!@ ,2@ ` 2@*  2@*  `P&``@(@& HOME㿘 ~; (7.?   "* /" **  /*N @ /@!X @@0; ""  @. 2 J @2@`@ 02@*  `@*2@㷐$@ b  [  !  - ?"?`  [ *? M4@J  !" @E ] 2 4@ [4@ !:`8 !`4@` 4@ - ` ] 4@`4@` ]` !&`   ]!&`   ?` !&` @    *@"  *4@` 4@@. "@!` 2 #"2?@  `* ` ,@ "@ 0@b( 㿘@@㷐 @  8 5  -   @`?`2`@*`2 `  ]@ @ 2 8 ``( `" @*`2` @  ʰ @*@`?㿘 ` *   `@??2@@  .㻘 1#7@:` @2` @0@㻘@* @2$@0€㻘@ @2(@0€    *@( `㿘@@ @ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘  !@u #e #e#ؐ @ @w 2N `? "`@Ґ  @  "@ • `    N  2 N " #"* #"#@ڐ$ N $ $ @ϐ#"`N "`@Ð#" " N #e#2a@b   2N `  2 ?|$ a@P   2N `  2  j$ a @>   2N `  2  X$ a(@,   N `    F$ 2a0@   N `    4$ 2a8@   N `    "$ 2a@@   N `    $ 2aH@  N  =2 @r$ @)N o2J #" N #  N "  " #"`N ""`@q 2.1# J A"`6`2 J\2 J ""  *`'# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@  =   /etc/ttysr㿘1  3#(3@ؒc8& @ @AZ  㿘 ! @  : $ @ /dev/ttyr+ `3#3@cࠒ d"P'Ē@ "@  "  @ٔT @؅Ԧ   ?'T @(@s@A !( ? $ @  $ ` : . .T3c@߶ Ԑ 'T  @Ȑ @ d!耤1@1 㿘!!4   @4  $!4!8` !0@) "a4+ !4* a8@%#!0 "!4@_!4 * @1$a8 $0a8@ $!4* a8@0!0&!4㿘8   !@@ ג  8 "`!@J!@  㿘!P  @G  @ 1 !T㿘@6   @!d  @X !T 㿘@  @i !d  @? !T /etc/groupr㿘!P "5@@'"  "@"    5@`("aP@ 㿘@ 㿘 "!d  㿘!!P @$!P"  "@ܞ" group.byname%ugroup.bygid: `'H '%195/ 7)5!T b @8v `$@n   ,J-@ #\#`!H@9ƚؠ@S & '$& & !H @7Ѐ $`"$@ߝ!H@8Р$@, @&Ԓ@@-@'̐$@P 2' @ MP`? "`@b P@  "@ }Pz +sM` :T  P@7* c` b$ @7ڐ [ @7!H 5aX@q3H@,5a`@8~Р 2@Ԓ@t@۵-@'̐@9!p T@9!p%@9!p "(H@A%?%@6ܐ @9!p` " @   $@o4 @9͒!p` T"@ @9!p%@9!p "@` % H ̀ !h% ")" J , ̀` *" J    ``""*" "̐  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐6#6@ۃ# c"L _@ S6" J@ J` 36J M"*6 k G"6 K (6##H6#H"6 m g6#H6#H6#0 !6#81 $6#@$!#H@\"1 @6#`@\ @>! 16#@\6#"1  6@%&@ .㿘p8 "c@O ( ~ @ (& `& $`& $@$$@@ f7a@T ]?42 @- @ݵ@ K8@B@6`2&``@&` $@ 6`4* 2  "6`4 &` &`% `@ ؤ@7a@ &"  2 4 $ 7! @+ &  $  & $ "c@@@ @ 㿘`&6`$* 2 `@ @K`@5 / 2 L    @D`@@8`6`& &`&``,& 㿘 " ` @Ġ T 2 6 @پ  " @  @ٲ@ٰ  $  @   8# @ @٠ $  `8"#?..㿘  $@2: 8 `48@۔ -44`2)44?* 2  !@̔ 44* 2  2 $ 7! @ $ 8#$ 446 464 U`" 6 $ @" , @" 6 " @ۣ   " @Y&  44   $@*@& $@K &   @?  8#$6 46 "b&  $2 @   &  $@  J& \@T2 28 $! @    $@   2 $& ݀ 2$@/ 44* 2    $  7! @ $ 8#$ 446 46 48 $ J? / @  $@ /*@&`@@O&@؟ T2?2 $@ؙ8"#&C  *@T2 26 $! &2.@ _ # "6 $  @ T !8#@ $#@  2 $ 28!X@ e " $ & $   44& 2`88  【 㿘`@8 F"c8"# $@2?  4  9 27   "@E@2  $& $ T 2   J / $ @& 7! @( @& @ڐ 2 @]  㿈'H $   @  H=  448#7$2 $ `  ?` 0 ''쀤'H2'@+ H268#$6 46'8#'@  '$ " @J? /B $    /- T2` @\   $ L` .L`  `?   `@m `  8 `@$ `@ 8 @c@@Z8"  $ " ? ` 4 $$ 4 2 `  6 4 6  4 4$  4 47$  쀢" $ `  "  $ $  @ $  #4 4 $   @ $  &@{ @$ @n  4 4* 2  *`2  ``$ &` j  @ @% $  ".&H2+ T2   $ @    8@̐!X   44 $ & $ 2  H   44 @{8 $ `<`6   @ `84 a  $ `@ 58`@ 2 &`&K @  8#&` @ `>  <  2) &`, &`( 6`0N`@ .2`N`A  ?`@c  2 ` 2``,"&@`R`2 6`( < (@  @    㿘  (&  @I*` & &  `"    @  "`" 㿘 $ D@א  @ @W* @ $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘@  㿘 a@& @ & `? " @""2  @"""R26㿘  @ 8  8 $ ,  ` @  ?@0 ?`,@8`(@8 "c?@M8 #@ΐ8"# : xxswufsswap ,rwrqro㻘9<"7 ;<+<<"P<"X $@ < @zb E@_ &J # @U$  @Q $ <@?  $ @8b( <"0<"8$  @9" @{S$  @0" z@{J z$ n$ l$ j$ h$ $ e`@b@ &J # @b@$  @b@$  @ b@ T$ $ $  @b@ "@{$  @b@ "@{$  @Ք#/ <@bH,<"`<"(<" @ <@̒ @ǒ @’ @ @ < @bH `I  @u OB㿘 @?   $ 1  㿘@/ 1   @   㿘@   "   @j 0 /etc/fstabr㿘 "=@7 0"=@zb "`8@#  㿘! @&$ fstab: : p=#P'А '="'ؐ '=#X' '@y@d''=#`' ' @A 㿘'L'P'T'X@vLvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx >!P''Ē@(ޔ   @x!'Đ@ ,*  J |J@ :`'   *`*  J@ | :*>a`@+r>ah@+m>ap@+h  >@.ax 2X    >@#a X $X>a@(M : "X $X>a@,=?"$(>a@,3$0>a@,,$,>a@,%$4>a@+" [@ ch 4>a@,? 4>a@,?,@N0$8$8>a@+?28@@4$<$<>a@+?.4H>a@+? 4J>a@+ה? 4L>a@+͔? 4N>a@+Ô? $P>b@+? $T>b@+?$>b@+?$>""7 `/>" " 7 `/>"("(7 `/>"0"07 `/>"8"87 `/ʢ ` ap/////Ē@+u?8&&Ē@+k||& Ē@+ex? x & Ē@+Zt 2 t@Z . . Ē@+M?   . Ē@*F [@1c.  * :  p ,`: ?4>"@"@7 `/\ 0/Ē@+"l? l& * :  4  !W$$@Ѿİ㿘@w@ "&@`@ Ne`   > @w㿈 28 ''   @S ? `@]찒   @A ? !8#@v$#?@*?@l  "c ./㿘 N h@"  " @Է /8JJ / h@"( "(*h `.   J /" @8J"  $1"h@:"h.8 ?"c x"`'"`"`  @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`  @'`'` `'@  &㿐'D D@ڔ 㿐'D D@Δ 㿘'D@D$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $㿘 @ 8 "c?$OpenBSD: getwd.c,v 1.4 1996/12/21 22:23:37 millert Exp $㿘@$Ԓ$ 2 8@v<#@#.# $OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $㿘.`&@2$1 c<@$ c<@$ c<@$̈́ c<@$< c<@$$ c<@$9 c<@$ c<@$ c<@$ c<@$Ä c<@$` c<@$R c<@$S c<@$ c<@$ c<@$ c<@$ c<@$8 c<@$ c<@$7 c<@$ c<@$ c<@$ c<@$ c<@$j c<@$  c<@$ c<@$ c<@$u c<@$d c<@$' c<@$Q c<@$O c<@$/ c<@$ c<@$+ c<@${ c<@$| c<@$# c<@$  c<@$) c<@$ c<@$ c<@$" c<@$  c<@$ c<@$OpenBSD: sigsuspend.S,v 1.2 1996/08/19 08:18:15 tholo Exp $ o c<@$OpenBSD: pipe.S,v 1.2 1996/08/19 08:18:07 tholo Exp $ * :"c<@"$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B c<@"` h`''' ''''' '$'('`'ДȲ``` 8 8 ` ` `@а "c?$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8J2J "$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘 "l?@  0,@%  4?@  0,libcUnknown signal: 㿘C#H@y[ Z’.  @z  @} .` ?C@zP@} .`@R "@}!@zH$OpenBSD: strtok.c,v 1.2 1996/08/19 08:34:28 tholo Exp $ 2 Jx 2J'   "JH? x J  H  2*? #"x 2HJ$OpenBSD: setenv.c,v 1.3 1998/02/02 22:44:53 millert Exp $㿐N@ ="`@@ "t @*:@,* `  f 8#x  `"  `8#x@̀*` 08"#x ""`@-*  %!8#x@ ,`$#x8#x,` " '  `=$ L  $@ 8x*` " ?8cx* @L =  = ,*    =, @,* `   㿐!8@e * #x `"  " @'L'P'T'X 7'@P'''D#'''@+̔L㿀'@w''' '@耢 &@ 㿘 ( 8 "c;?@Ɛ @2 P (     ?2 2 $? "  : @ c  0 "  < :@ c "  `"   "@: @ C 㿘`6 "@"&&@+,(  @ 2,  @ ܒ`"&&@”@ܤ,㿘<"e@' #4"E@&$  " @+  " @%  " <@ < @@No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N " 8'@K$ E#' '8@ #@?$$  E#$ $ ؔ$ : @Resolver internal errorUnknown resolver error \F  \F * /etc/servicesr㿘!\#@  \F!F@rba$#@@.#@8cl"cl㿘!\#@ "8@$#@8"#l ,/㿐!\#@  \F!F@r<a  $#@\#@@r m @J? '#\!"@ђ,N #@zH # 2,""F@pa \. N "  " F@pa \, @q|b* 2 "`"` ""`F@pma ,  #$#FL    & @pUa ,  2L&1"/etc/protocolsr㿘!\#  \F#F@qc$#@.6#8`("`(㿘!\# "8@$#8" ( 㿐!\#  \F#F@qcЀ  $#\#@qՒ b @J? '#\!#(@#,N #@y # 2,"#,G@o`` \, L "  " G@oԒ`` . @pΐc,"`#8"` #1GL    @$@`@o ` ,  2L$@1#,/etc/networksr㿘!#Ȁ  G"HG@qbX$#@-#8ch"ch㿘!#Ȁ "8@B$#8"#h 㿐!#Ȁ  G"HG@pbX  $##@q3 r @J? '#!#̐@́,N #@x # 2,!$#@^ #* G@o<b蠒 , L "  " G@o,b谒 . @Fdc"`  "`#"`    h1GL   @ $@`@  8, @o"蠒 ,  2L$@1#Ёgethostby*.getanswer: asked for "%s", got "%s"-_/㿘* & #H ( (А (:`a@@xy 2  .2  N .2 *`߰  gethostby*.getanswer: asked for "%s %s %s", got type "%s"㻀'D''"!  D 2 D?# @"8'$'耢` 8 D@j貒 HD쀢 `8 @̅ "a'"'a!"!!" a"a"  *?(D@jZ貒 HD쀢 " @k* 2 @k* 4 @k* 2  q4 1 4@D@j,$ HD %@`@% '"'@ 耦@4ͨ @\  #&#D@i$ & @k. " @ 耦@4 @[''"' @< @<@< %Ha@K" ; 08 0}@nm쀢  %Ha9D@i貒 &k @j쀢 d  4@%@`?S @˝ '"H'@n6쀢   %Ha@J< @26 @z  @'"@'  "@'@ "9@  ! '%@'"' " ? D58%@% "̀  !!@!! 8@+ 耦@8@[/$!'"'8!p@!@a8"#1!8 "c 㿘8!p  8@e?8@ 0!p@@   @ bf㻈8!p  @e?`@ `` 8   ?"c8 /"c 8 "c !" " @vL . 2L@@-z 2 L@e   I4L ."DL@ @A۔< !"8@vD , !'#'!"!a""aa "<"a""8!p@ @ɔ8"#1!J@e   `.2 L@J@ 2J@J . L@e`  D@u : 2L@L@ :DL@ )L .< @A< ~!"8@u , !'#'!"!a& "aa "<"a"& 8W"#J@e   D2`:. `J@ 2J@J . 8# @a O  Ja@u  L * f" y b  2 `2 @ @+$  @   "L%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈8!p  @d? @ߔ`Kb@%  Kb@%      8  /   8 "c8?"c ,8Kb(   @[r ! )K "H @[g2?@K"P "P,@ `,` `,` `,` `,` `,` `,` `,`8# @ O耢  Ja@t   "<7!8!hJ D f"8 y b 6`24`21`@,  @*$ $N & & @_& %@@7 &  & 8"#@'`` /etc/hostsr㿘!]   ]L!L@l:a$ @( ]" 㿘!] ` ]  @j $  㿈!]  ]L!L@la $ 8 ?] @lZ 8 "c @J? '#]!"8@ǥ,N #ސ@t # 2,L@jhb@ 8,!p@    @?<    1 @?"< 8!p@"<@    'a "<"a"!" " " L "  " !"!!"`L@j"b@ ,  "4#LL    & @j b@ ,  2L&8!p@ "8'$'!@[8"#1!㿘8!p@@   @ 㿘 1  @j   @j   0㿘      @#2  㿘!"!a" "  "  p!" L@ib@2 ,!2V$@W $@gVLL "  " M@icbp  L " , a "a!@& "4@ $@`  "4)LL    @$@`@i/"@ ,  2L$@$1!%u.%u.%u.%uhosts.byaddrx !!@ (N`X  @Y$  '@ò$#@aN`h@ d܀  S 8 "chosts.byname㿐 @ )!! @Ȑ ! %@{$!@ܐ!NaP@ .   8 "c㿐@  .@  ` .@`.@`@  㿘  - ) &  &   ! @ $ 6@&&@" &@@&@ &@?&  2@㿘P @)8had ad.lh.  .. ` 1 ?(Q& ޸ `@,`.(WW 77. #& `@괇./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345 *`2` MO؅(0J  @ J  ` @ 5 2( 00**J  @ ` ( `<0*J  @  `(* %2.2u$㿘 $. 2.  a. .   O@. @6㿈  耎 . @. 2 ,@ * 2  2` ( 1 "В Ζ "ЁOrpheanBeholderScryDoubt?#Oc@m `N@ 241]N` $` a21] ` `N` $2 1]@h* *#?1] c :` @0``8  @?#@ @l  ?#@?#@ @@   ?#n7 ?#?#n?#x @ܔ,```&  ?#?#x@@@   ?@ ?#@?#x@,`` +@  2 # ` +@  2 # ` +@  2 # ``+@  "P $*@ 2*`` *@ 1 "P $.`@ O@  ?c@ @  @ħ?c @   *2 /O(0@ 0 *   (2 *    ( * 2 *  ? * ِ *㿘@7 (?0;?c0( (6(00((7 (00( ( 6(00((7 (00( (6(00((7 (00( (6(00(( 7 (00( ($6(00(((7 (00( (,6(00((07 (00( (46(00((87 (00( (<6(37`/`h(@D&@&㿘@D7 (?0;?c0( (@6(00((<7 (00( (86(00((47 (00( (06(00((,7 (00( ((6(00(($7 (00( ( 6(00((7 (00( (6(00((7 (00( (6(00(( 7 (00( (6(37`/`h(&@&1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#T`0#@:`H@6`H *`2`*0 : * *0 @  2㿈7 .#6, 2` @ "@ * 2  7'' #, 2 *  "@ * " * 2    , 2 l.`2 * @&  * &`* 2   * 2   㿈7 / #7 , 2` @ "@ * 2  7'' .2 9u@'n@'!, 2 *  "@ * " * 2  ߐ .2  , 2 J 'C '.2 * @&  * &* 2  ߐ * 2  մ 㿘 .06㿘. * 2 Ŕ` * 2  `㿘. * 2 A` * 2  ` ]h `?* 2`$1$$# $cd!]@ cd@  @ cd $cd  cd"#h @  $   #d h@   `"h `  $2h % #hd"@@6ǐ@Đ@6ђ!]@ @6 d@6Ɣ8@6@@6d@6@@6@6@ 耤  @6?   @ @ ] @6 <   ]! "@K` "cd@gB"Y@KaX@6 8@6d 8@^ @6g@ђ   8cd@6]@ǒ   @D@6Q 8 @8@6D @6r8#! 1 @)""$#`**`   #` $#`**`   #` $#`**`   #` $#`**`   #` $#`**`   #` $#`ޔ #``$#`*` @ %s: 㿘(!d"Za@8`"d"@{d"Z@a@㿘@D 㿘? @<  mX mP m@ m8 m m m l l l l l l l lp l` lH l0 l l l k k k k k kx k` kH k0 k kUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @_  " @J3 $]a$ "a @x 㿘]!耤 " @q 2   2 㿘]!耤`" "!`@X@@V 2`]"!㿘% |!#']$|` (J@ ]  ?@  |@"@| ]!"``]J@ ]  ?@  `@ڒ]!" @~` !" %]`"`` "` `"`["p"```]J@ ]  ?@b  `@" @Z` !" ``]J@ ]  ?@I  `@]!" @@` !" ` `]J@   ?@0  ` @]!" @'` ]]!" ]!`$"`$  #"cā: 㿐 'N@J `:'`J '!\@ &@ & @ޒ 耢 "p @[& \@Ԓ`耢 "f @[` & !\@Ȓ & @Ē 耢 "V @[& \@`耢 J @[& $["p& & & $!\@ & @ & @ & ]!`"/ ]!䀢  ` 2&  #Ā  ]! &  #Ā ]! & ]!  2& ]!  2& ]! 2&  master.passwd.bynamepasswd.byname` # @l > @B! #   ##   @:  $## "]   cȀ N c # 0 @> "\\#8#P !  #\#`c #@6ذ@#   $# "#䀢 "'@'"c i"c@# \#8\#P  @ V J"#Ԓ@p̀ @Q J  @# \\#8#P@ЖИ@4 $+ !쀢 . @̢# "\\#8#P!]@!@!@ "#@S!쀦  $!䀢 J@JF c@@A' 9"# c*@1 #| 0f#| #`"# 2/#@ ' '@ RM #|J@ +  J`  @     "c "c #|@ 0"c #|@G ]"a#|J@ -&1 J` 쀢 @ @`Ԓ@Ồ  Ѐ`J@ L @:Ӏ#|C ΀1 #| __YP!+p^ ' ' 1/^ @v '  '1 #   # ؟   㿈]!?'@  ] ##  @А  #\c8@耢  ]@|] "a]"! p # @ "6  ?   "c1 3 % /\-\) #; #Ȑ 2/@  ' '@ϐ #|J + -#|0c @{c  #|J   @N  @#$c 8P@M @$2#|@ ܒ@Ԧ @b? "J W 8P@Tؘؖ@# ) "$@$"#|@$#| 7'؀ 8P@4ؘؖ@#   "O$@K$c@v##.#| =<#| #06J ``@@A ܒ@{Ԁ  ؀`J@  @#| #|@m  # ! # @$##|]E"!b c "c   # ! # @$# ]-"! 1/@  ဤ  @ ' 4  '@͐ #  `! # @$#` #| %umaster.passwd.byuidpasswd.byuid` # @~ "8 T ?_b@G{   "c1 - % ) #; #Ȑ#| 2/@ ' '@| #|J + -#|  @ '  #|J   @T  @$/ __"#@)S @$2#|@O ̒@Ħ @ ? "J  \\#8#P@Ȗ@Ș@M# , "$@$"#|@$#| 'Ȁ \\#8#P@Ȗ@Ș@*#   "M$@bI$c@##-#| ;#| #04J ``@2#|@ ̒@Ā  Ȁ`J@  @    # ! # @$##|]9"!^ c "c   # ! # @$# ]!"! 3/'@ ' '@~ #  `! # @$#` #| 㿘 "# "# "# # " @ r"#]"! 㿘 㿘 "#! # "  @$# "# # " @ Q"#]"!/etc/pwd.db/etc/spwd.db%s: %m㿘 @ "# a!a!   @oј  "c  #p   aa @31  "cp 㿐 #  r  t@ a"t! @#x $#xb  #x "#|,*     "#,*     c@   c@   c@   "#,*     "#,*     "#,*     "#,*     c@͔  &@ c@”    "c $OpenBSD: getnetgrent.c,v 1.7 1997/10/10 23:07:30 deraadt Exp $*netgroup: %m㿘@ 2&  b@ ` & @ P & b@ `㿘   2& @*` & b@ ` * "  & 㿘`  .`@ ` @*@@㿘  , @j   * 㿘 @ e `  2`*`:  `L@ e 䀢  J` @   "J * :  e    ` 2 L L   L & "``&@  b@ `@@*? & 㿘@  2 b@ ` $ ,  ,   )~    "@ @@ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀 '"Ȁ/ @@ @,@`@J?'' ?b0@@Bm耢 & b@ `& @0ϐ#@ 2" c31b0 c0#  @@ T䀢   netgroup: Syntax error `%s'㿘J "g eJ@ #"b J " @ `     &J  2 @J (28 &c!x@0f;?9 L  ` `J@ "`&J`  `     "" @ &@ b@ `@@@*? J@  # netgroup: Cycle in group `%s'㿈l  @c#P@00/1 1 &'5]m耢  ? @0 " &㿘  ` `@h  `  @hݒ     @hђ   㿈  @c#P@/P ʒ 1 "F '耢 : ?5#  "@o  "@h  @a@_  Ȑ@Q @M %s.%s㿘@   b@ `aN a#`aN@ a#d@v(%s,%s,%s)㿘d#( d#(`d#(d@vq㿐` @h" @b@   ,㿘ז   Ж  Ɩ     # @&7e@ ؒ "NN? ,2 N`@[  @ @ 㿘]]a`"""#]` $a@ ""@"  ""@"  @~@|"a$" !"#Ȁ  @$#ȁ/etc/netgroup.db+㿐|']! !"#Ȁ  "e"   @k $#"#Ȁ   eba 1 @>0@:@?  b@`"]]b"!u ]" ""@"  㿐'!"#Ȁ  "e"   @kF $#"#Ȁ  @`eb 1 `@@`  `  3`  2  2 @?{   /0  8 "c #@ Ұ  /,@]&@08 ".#@l d .-@-`f @} `''8"# @} "Π?! .@ @ .- - -@e\ |`@ u /-   @i a8@/ `@i V8L` .2 `L` ?`   ``@@}Z 88" ` $ @ 0 @ `n$&.`@#  &@ 2 `? /, `$ `@@e-n c `"c "c`@ސ@ܐ @eҐ 㿘 "#Ԁ ""@""#""# @&""c!"@   $#""#ؐ @>% 8 "c?K:  J (82J*" J  JKJK@:  K:ڀ  2K K@  㿈#\?@ %s.dbtc㺀'D'H'T` 'X{? X"#Ԁ@T"#@!$W"@=c'"#Т`d@$ H     @';g @s   @i[ #@6T @@ @n@ې@y@ H D  @| b ' @$ 4 @耠 @> ?+ L  @($,@L \2 ,@,@`@ ܀$@%$@ܒ 2  8 耠Ӱ?@ϰ?Ţ,@``L " #"@T 2\@$ 2   2\  @??  :gbД = v  `:" L  ?$#\X 쀦? 耠@@P0n,?" ?2,??ɲ   `: L  $$L? :"$,$%%$@$%%@@@ 2 8 "c耠0@x,@Ȕ$@@Ĕ@@?耠$@@_$@H @ D8 "c ?@?0D @ 㿈@B''  ? J@?? `'? &@J `? J2 JJ|: ?  ?J:|?  㿘@@㿘1"#܀ ""@g&#""#""#""# r㷈"c䀢 ""c!"#܀  ""#i@O2a c$#"#Ԁ` "؀ !" "Z !"#@Ol !#܀`` @E"@gU#"c"c " 0#i@Oa" "c0/*? eL@ @  2 `:`#"# J? \"" "c""#J? \ "" "c@g x?0W"# '" *`:  :",J \ , J  ,  @N ܀` ` @@fߐ $ܐ*?O J | :*J *#\?S    !㿘 = ?@w d  d8 "c?  :j"T*`:   ^2 N N`:` x* \2t N`:`}?А   * ?N  N`/`7$* Z*?* :  2N *  h t \ D t t t t t t t 8 t t t P t , t t t t t t t t t t t t t h t \ D t t t t t t t 8 t t t P t , * * * *  *  * :*?**  "  @!`d g dN :k*" `? @" "?&㿘= = 3?@ d  d8 "c)? @ : "*@*@`? `"@  @ d  dN@ :@*@`"@ ? @Ւ"@ "?&㿘 # 2N@2? 0  `N@ x X `  @А *`: ?А *`:  ?@  *`: ?ɀ @`& 㿘N@ :2``.`@a.`㿈 `2,`@z,`  @V & ,  &  &㿘'L'P'T'XLӔ 8@8x!8#@-$#?㿀'L'P'T'XL  * j ?#`L# * #  @㿘'L'P'T'XL @2!8#@$#?㿘8@x?PATH/usr/bin:/bin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/sh㻐 N8 "c@T /  E'l@;  l @9Z'l@`@ sL  l H@@@ $l `P@  @l ``@ l@8 /,`@1@ ,8@sx8#   l=` &`07 @   , @ 2  @#*  %l x&& ` @, 8l @Cx@:` 48 @)U88 c ` "c`@!?㿘'L'P'T'X@'L$ c<@$ c<@$ c<@$; c<@$Z c<@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $ *`:`J "J $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐8J P  @    8 P&8@+ P`?$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX "x N"t @ @ @"m N@"i @ @('b &'@&@*Ā _W !''?ؠ @ݔ ''` #\@` 4!  `` `m@=?aXĐ?"`h@)mఒ 2#&@  &  @*@'@@  '  @@@*@!@YX@+ā$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘&8 PJ P  8 @('! 8  P& $OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@HV"#耤      2  2 @  ' @: "#耢 2$""#  " @$  @$ @~  $ @y $ @ $ " $ $  @  @     @^  ]@ @73 $ ]#$@$  㿐"#耢  ) & '$ @G"#耤 "  2 @^ 2 @l 2 @$  2  yp_match: clnt_callX @" L@" @ @@" N@" @ @$' '@@(Ā 8  P@^6 !_쀢 '@@ܐ  '@*f @s@@*@@)[ _!''''''ؠ @b ''` #\@` !     `n@;ĒbĐ?"`h@'谒 2#'@@  ' @,@@* 8 P@]Β  @ " !@Wݒ@)āyp_next: clnt_callP\ `N"z @ @@"s N@"o @ @$$d '$'@@' _Y !''?''ؠ @ؔ ''` #\@` !  `` `o@;:aP?"`h@'hఒ 2#'@@   '  @@@*@$@  $  @*@!@WS@)$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  c<@"` $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘@N@ `@B, : N   *`: 2@  2?$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $pؒ "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  "  JJ@`    9e;@`` @  `%  4@_z 2@    "@  ?&  &2  @`xײ`q 8,`  t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t  t t t t p t t t t t Ƥ Ƥ Ƥ Ƥ Ƥ Ƥ Ƥ Ƥ Ƥ Ƥ t t t t t t t t t t nj t t t t t x t t t t t t t t t t t t  t t t t t t t $ ǐ ƀ Ƽ t t ƈ t D 0 Ɯ t t t t   4@^ڐ 倥   ?&  C&h f d @ l2` `] ,* WТ  6   b1  -b"* ( @ @!  @ "  b  2 @ 2" @      ت    @@^y  @#`    `%e  ? &  &@^_ j   2 `8@r p,`  Ȅ 4 ʠ ("    @:$@&@^5 "  <@ "& & @R )"? *  J `` ?&  &  4 @] "`"0 L 2``e@ J   ?&  @,`&  4 @]ѐ "آ0 L@ 2 "հ,*"? &     !e` ?&  &  4@] 2    "`    #e ?&  @,`&  4@]z 2 , `  " ,$8!%]#| Հ M* s H \ \ \ ̀ ͨ ͨ ͨ ͨ ͨ ͨ ͨ ͸ ͸ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ `$ "$" < :-`U <-`U`` %! <  ! ?"񀤀!  =, ? &  &@\֐ !2s! (ݰ @?ذ `x`X @3 ,  2  : 2"8!'ls#t Հ :d*  h h | ` ` ` ` ` ` ` ` ` ` А А > "! ?"! = %$ 9!, ? &  &@\1 !2!$5 @- `e`E@ @ ,@   :"$m? ^      *$* !? * -  ]** ]6  -* 㿘 @ 0 2 4@$ $& 0& 4  @,& ,` 0@<  @&& 0& 4 ?㿘?.8!P 2` @` 2`0 "I?`  @ 2@?` ?6` &`&``  6` `0  ``4@& @ "@(?&@*`! ` ?6` ` "`@@( ` 2`&@`  &`<@&`8`@&`0 &`4.`B`B&@ &`㿘 @   ?6 8"#88!P 2 (@ (8N  C8E ?8A @ @2 P     ?2 2 !? "  : @ d  0 "@ < :@ d@ " @`" @ "@: @ D@     "c  2 @U (ɀ$ #l2 V  & @ޒ 2  <   (6 & L $6 2V  >`@Ē >`Ȫ@ B 2$ 0 @"  P    ?2  : @ d  0 " < :@ d 0 "  :@ D 8 "@ @ d  < "@ @ d  @2& L4# L@8 L @ D4%@2 L@%@ @&$ &  0`[ @@"X& 0@ T& 0 L :   @   ?2& $&  & 0` @@"& 0@ & 0 ?ߤ@46 @Z    & "$& @ 2 ?>`   ?2 0"? 0` @@"& 0@^ & 0 &&  ?6  㿘@ 2& @" &&@&$@@Y $@@"&@&㻈 ?$8!p 2 #\@9s2#\8B"##`$#d @К 8 1"c@6 68 &"c 2   `w $*`  T ` H < ` `8  8 8 8 "c?㿐' 8!p  @988"#8"#8 "c N J@ .d?`J@  .@ J .`? 8@Ȑ t{8"̑2  ? @t 4k8#` 8!p 2  @`?`8!p":` 8!!28;8/8!h@@L 4Cc =;㄀    "  2    2  "" `@  ֐`  @ 8 "#8  ?8 "c?%.*s.%.*s㻐8!p  @8h`8"#(?`@e?"N .2c@ , wcP$ @/PHOSTALIASESr㻐8!p@x@W @@ 2 x@@`P  @/> 'e+"#@@Ȓ v@J? '#@,@O   2LO   2Le  L   " L C,@? Đ L   e  L  2 L )L     cL     ce `L@   "`c@HU$,@.$@XH0@XE H`8!p  d@7`8"#?` @> @68h2@4@ *` @* $@*` a > ?$@` ?''D?_?2]?? Ґ@: ʰ$.2 @< .2 @;  B5  ??@:  @; .2 @;  @;  @;ߒ  #5 ` .. 2 @;Ғ .2 @;͒  @;͒ /`2 @;Ē` @` 5 &rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4y#*`    , 8 D P \ h t    ( 4 @ L X d p | 1y!@1y!H1y!P1y!X1y!`1y}!h1yz!p1yw!x1yt!1yq!1yn!1yk!1yh!1ye!1yb!1y_!1y\!1yY!1yV!1yS!1yP!1yM!81yJ!1yG!1yD"1yA"1y>"1y;" 1y8"01y5"81y2"H1y/"X1y,"`1y)"h1y&"p1y#"x1y "1y"1y"1y"1y"1y"1y"1y "1y"1##y@,`b#icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`<{ p*`  D  D  D D D , 81z)#1z&#1z##1{  1{ 1{ 1{ 1{ 1{ (1{ 01{  81{ @1$ y@,b 㿘8"ȀE  !"@s'\ 8!h`  @ @8  @9t* 2  &<`8"Ȁ  !`?  '`@ * '@  @+X㿘d@b@;; res options: %s㿘{@rڒb  8!h#{ " @ @rʒbȠ2 `? &`@ * &@ @+#;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈8!p @4?l 8"Ȁ  (^ !8^a2 <^! *{cp@  @r3? & * & @*8"Ȁ (8?`&@ ; ;* &@*w8"Ȁ "@8{@rc2  {@qc${@qc"{@qc!{@qc {@qޒc @{@qגc {@qВc {@qɒc8"Ȁ !8{c@q!?#|`@q |`@q|`(@q 8"Ȁ +"? & * & @)t8"Ȁ  "|@q`8 g8!h!`  @|@qy`H@!`   @ @6$ @ `t@o!`  " `!|@7* @ё2 @qK P`@[!`   @7* @Ƒ2 |@q7``!` ` " ? &* & @)<!`@/?#| p#\  ٚ $@| #\ @˚ @| #\   0 |`|`@p㿘"㻐@@5$ O ?`&@ . .* &@)'@)˒㿘"Ֆ.㿘@5^ & @` @J? ."`}  # #.  *`㻐 ؘ$ @)0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c8!p  @18;"# A$ 3@(@6H* 2  @6C* 2  @6C @6:* 2  8"Ȁ $8~``@oǔ8"Ȁ   @H~@o`h@9~@o`h`e~#*`  <          p D0p p  Ȁ  2r?` @}N ?!T?` "@@@~`h2Z?!T?` "@@@  @5y * ~`p @o 3 @?`&@  * &@'dm 2(< ~ @'`6 4#~0`@A2  \?`&@ \* &@'7 ?`&@  * & @'"? Ҁ?`&@ " "* &@' L `G ~ @'`4#~0`@@  \?`&@ \* &@& ?`&@  * & @&ђ? Ҁ?`&@ " " 2~ @'b~@nL`?`&@  * &@& "} ?`&@  * &@& d~ @')@4} ~`@n@4t@& ~`@n@4i@ ~a@m@4^@ ~a@m@4S@ ~a0@m@4A* ~aH@mؕ2 K 2 @40* ~aH@mǕ2 : "  ?`&@  * &@&" 2 ~ @&`6 4#~0`@?  \?`&@ \* &@% ?`&@  * & @%ג? Ҁ?`&@ " "?`&@  * &@%@| "%~?`&@ "* &@%`5 30@?~  \?`&@ \* &@% ?`&@  * & @%n? Ҁ "?`&@ "* &@%Y ?`&@ * &@%F  ?@  ~`h?   @  .~`h?` @ ~`h@3* 4  @3*  ~aP@l2 !~!X@l !X@l !X@l 2Ѱ @2* 4` @2* 4  @2ݐ*  ~a`@lq3  2 ?`&@  * &@$ʔ " ?`&@  * &@$ 2m ?`&@  * &@$@%4T2R@2~ap@l HD?` @z!  ?!T?` "@@ Ґ@~ax@k  @+%~  `@$ @$ ?`&@ * &@$<``, @*?`&@ ) )* &@$"?`&@  * &@$@2 * ~a@k2 ~@ka ~@ka@?X"@ @ ✢ %~?!X@ ?2N@kvN?`&@  * & @#̒ 倌 ?}@1*  @ؑ2 {@kQb ~@kKa @9@~aД@k>@1@" ~a@k3 @1@I ~@k)a@1@@ {@k b@1* ~b@k2 @?X"@ @ e✢ &%~?!X@ ?2N@jN?`&@  * & @#P 倌 ?~@jޒa`~@jؒa@(@~b@jΰ? & * & @#*&~b@j ANYHESIODHSCHAOSINphXP80(      xpXP@80(ph`X@8 `!X@"8d`eX@f8 #"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘   @24  2 2 &   2&㿘   2 2&   2$ y@!jb2&1$ 㿘   2 2&   2$ 4y@!Kb2&1$ 4㿘# 㿘#t initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1$&'161$+1@"#1+1$$11"1$"11$1   1   1          H@ ’a H0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘 $p"` "`*p `.  `.  `.  `.  `.  `. @ta <@y <@tZ <@r <@tS @k $  p "x"bh@ m L 2 `  , `"x"b@ U L 2   `, "x"b@ : L 2  2 1$`21$21$  `2,, "x"b@ 1$ p%ld.%.2ld㿘 2 @sג   @sђ  `^P*`@, @ d@s’ d1$ a @ 㿘  @* : e `   `+ @ *`Б*: @`L@  + L@ .+ `L@e @  + Б* * `L@@  + Ж ` *  *  ^!P *` ` $ ^aP,  @@ 4 * $ 㿘 (8e`(`(Ѕ.8N(`Ne N2(8e"`) (Ѕ.8N) Ne N2(8e"[`.`(Ѕ.8NN.2'NNeeЅ/ ((NЅ((Ne?иNe2 NN"Ne N2(82\d(#0#########0#####t####t##############0#########0#####t####t(` (.  (.  ((  (` (( (( ((& (82@($$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$Ą # ##Ne2 N`N"Ne" "`N2"㿈     ''@'@`\@ 2& @   2 쀢 2  J@ - +?`'J@ +`'Je @ ` , * ?Д J 'J   J@ .2, `'J`e  ", Б. * `'J`  `?а ', @*`@*`@@&%b Je @ `  @ `'J`   Je @ `  @ `'J`   :t.@_Je @ `  @ `'J`   Je @ `  @ `'J`   :=.@(Je @ `  @ `'J`   Je @ `  @ `'J`   :.@.@.`.`.`4.`4.`4.`.`4.`4.` 4.` .` 4 .` 4 .` 4 .`.` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smX  @b0/ / / * *  *     * *  *    * *  *  &%"&%"" ??ڐ!   N S @p˒#'@#@pĒ <'@ܒ <@p <@Ւ <` W  E@p#@ƒ#@p <@ <@p <@ <@p d@ d@L @X ^!x@P ^!x@H 2#\^!x#\#`#d#h#l#p#t#x#|##b@^!x^@y^!x@^@r^!x@k㿘@ː  6 LL ." `@ &L L * 2?J? .2 %04d%02d%02d%02d%02d%02d㿈'@Ȑ`'l#`` #``#\@#`1$ b``` @` ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 @A %e'_@< ` ."6 +"3 /"0` `/   *  `@  D" А   *  @  D"  ,  .@```Ű  $   6%* . @0 07* @` 07*6*& @* 㿘   8@ @W /"c?0123456789㿐 /N( "@4/  . @* @*`"@`#2,@  ,@2 `,@ N ް  .@.`.`.`  0123456789abcdef0123456789ABCDEF㿈 @o N :   N :p H  NA ?##@3ϒ #@3ǒ  ",N %N:. `CN`=4,@`,@` 5 `1d  0*NŰ   ` 4,@`,@``@$@   % # @ * -@ @  @   㿘   8@ @$ /"c %u.%u.%u.%u㿈b0  @ @8 "c %x8 @   4`@: * * $@#* *@ @``" ?''  ,`  ?'' '??Ā@$''''``,`? ?Ā@''?Ā Ȑ?'Ȣ  :?#@  Đ@@ `@ 20`,, ``,  ,`Ā  Ȗ$  . a" * @ ,`b@ `` Đ@ 2, :, , Ȑ$ 88@ "c %d.%d.%d.%d㿈'   #\1$# @Lx#㿈 N 0   N x X2  * &'e:`   @{?*:  `D` *??  *`:`N .2 N@ $@`  e   2$@?$@$@ :  耢@ **` ``@  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=㿈`G #h @/` @/` @/` `3 / `*` 2 @/ * 2 / ? ?/@y逢 ?@s ?@n ? @i^. . . .` `E //@ / @* `@ `2 / * 2` / `*`2 @?/@3逢 ?@- ? @(ch @.  @.`  =#h .  =. :?.?㿘 N@Y '#he @  2LN`=M@1Kh W "`   `;N -`5N@D"@* .@,  `;"@:`@ .@@ `*`* ` ` `*"@:`@ .@@ `*`* `  @"@@ .@` N` `=8 N    `1 .,?` e @  `=N` `=2?N ` e @  "?N` ` @ ?0?  + @+@  @0(@( @(     +  @  ( ( ( @     : H";j" &."  v" 㿘 * 2 2 `? 2`*  *` @ B >  @"   @@C  ?@?@ @ ?    @@Ք&㿈` '`'  `*`2 2 `?`7 x 8" ^cȐ   i  @ XP   'o @5ک x@. @/`7`@@:1#V@. . 6@  ۶/ .6@0os"/@ Đ/ 7 @=_#@. Ȑ@/`7`@@"*@. ̐. 6@* "/ А.6@?Q!/@ Ԑ/ 7 @`& غ@. ؐ@/`7`@@"=#@. ܐ. 6@?֐#/ .6@"W5#/@ / 7 @!"@.  @/`7`@@?f!@. . 6@)P#>   .6@m !>  / 7 @=!b@  @/`7`@@0,#@@  . 6@ "Q/@ .6@:m#. / 7 @5Đ ]@. @/`7`@@ S@/ . 6@6(y"/@ .6@9#ȸ. / 7 @xs!@. @/`7`@@0#ִ@/  . 6@=5C!/@ .6@V . / 7 @*x!@. @/`7`@@?;#@/ . 6@"ٶ/@ .6@#J .  / 7 @?!B@@/`7`@@!}"@. 6@gX!".6@?yN  / 7 @)/"D@@/`7`@@#@Ȑ. 6@=Ґ#`.6@/ p/ 7 @ &ߐ"ƺ@@/`7`@@:I#@. 6@5;̐ .6@"!/ 7 @6u4 9@@/`7`@@9!@ . 6@蟐 .6@1+"e/ 7 @= H"D@7@/`7`@@ʿ#7@. 6@*#6@ .6@?$ 96/ 7 @V֐!ú@7 @/`7`@@#3 7@. 6@? }6@.6@!a!Ѹ6/ 7 @"O@7@/`7`@@?9"7@. 6@(P#6@.6@!6/ 7 @=ߐ"@7Ȑ@/`7`@@/N"57@. 6@ "6@.6@:ᴐ#6/ 7 @@& &  &  &  @ @%s: : %s 㿘8#(!d"cP@Z8` "@["@ZcX@#d"@Zc`@㿘'H'L'P'T'X@!H㿘'H'L'P'T'X@!H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~_* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #bӔ#_ !<: 8##_!8@!Ԣ(@Fq6'@$@ iԖ@ߔȀ6?@$_!0 2_a4 _( 8"a4_!4 @FI؀6?@$_!0 _@1@F76?@$_!4   :,@`?  ,@`?$@* $':` % N` m `@"\@F ؀6?&$`,?`@*`:`,@ٖ6?@_!0 $@ '%@ &'"' ' @:”$#Ѐ  ___a0!4`@/ _!,@&{ _!0 " @Nx @+K > 'ؐ$@&'#' '@: @~/dev/log㿘 _"!4_"!01__"!81_!,?!#_!$#Ԓ @ j#Ԑ j,#Ԑ ,``b@+. g,`i_!0    @/4 ?&!, @EH #_a,$#Ѐ  $c@  j?$@~[a,$a, "cЁ㿘!_@~Q!,?$!,$"#Ё_< <㿈 ''@ 㿈 ' ''  @ ?? $ c<@$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@ s @` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@ R  @a` @` $OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@  @T` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@ q  @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘@2$$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@2d @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘@1$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  $(\\\\\\\\\\\             $OpenBSD: yp_bind.c,v 1.9 1997/04/29 21:25:20 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D !H@L?c @  ?8# #@|V @|@|_"?8 H "" H `" @ @z; 2 `8" H_`""&@D - @} (8 H  D@5D    D 2 h@y l   @} l?& \& h  h 2? h$`pD@Cc @L ?". h@ 8# #' 'Đ'Ȑ '̐@ ̒@ @|;& h@|7m@|3"Ͱ @yːɰ   А @}=  /А / 'Ԑ?'ab  @ 2 @!" @y # 2 _  @" @y !'''' #\@ |D#L耢 " d"a@VD  @?d& h  @ / /# 2  H"Z @yXV  @|ϔ  . H . I . J . K . L . M . N . O J6 X & h D@(O @. D_!2  : '' `? @ ?& \''Đ Hab @) \ & `@!& h \ @BO ?@!؀8`H&"`H`2&@ 㿘 ` `@& `?& \㿘 㿘 8 H@4  2 ` `@`$@$H@xՐ0 $OpenBSD: strftime.c,v 1.2 1998/02/14 21:03:48 millert Exp $g ggggfffffffffffgffffxfpf`fPfHf@f8f0f(f ffffeeeeeeeeeeh%a %b %e %H:%M:%S %Z %YPMAM%a %b %d %H:%M:%S %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@'#(@("* ?%02d%2d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y  /+*`:  %… M`y d*` jLoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooojTjjkh<omk8kDoookoh<ooklllmnhno,oPoooooojpjjkk(omjokdkxkkkokokllln\nno [?` I* G |` B* @ `` ;* 9 0` 4* 3`'l@q7 dc D44'3 "!` c` c`c`@` " c` c`c`@` " c`c` ߒc#` $##@͒c@'`'`'` '`'`'`'`'` '`$'`('@ tȔh@ 4c!#``" @p c` " c`> @p : `'l``?`!m@` d  !n@`~! !m!n$@`w ?@`s $?& ׀ؐ$`2ޤm@`b d 2פn@`\! 2ѤmϤn`4`` `2M` 2M 5M V2M Dc g? '@`: d:cO#```  " @pF *c`&c< 'dLdd d 'dd@45'4  '`'l@` dc`'lc@+"`(  ` `_"*` ㈒@%  .  M 8@ U@  *(  *GMTJ( ( ( __x "  %H%&+%@* ( ( " `*  %D%@&_+ ؅(( ( " ` /etc/localtime/usr/share/zoneinfo/?` @w  N : /N  /"  N /@$Z .   2N! ""?N :" N /`?`"!"?@x@x $@@Òa@@$( . 2 `@  2?@GA ??` @w@@wu 2ܰ?? 9 6 3 &@0 &`- $&`* (&` @ 2 ,``a4?` !r4?24?  2?`@`2?? $ & `* @`* * @` @@* @@@ ?  . @ "` `  *%ؒ ``@Y `@ , 'L@͐&@ $` E $``@` @4Z? `.  `  @#L@ *  ` @cL*  @#!L. @&@$` @ * 'L  @L"` ?"`  `.  * 'L` @L"`  ?"` `.  mn ( 8+  (:` Ѐ ,-:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *`" * @ &@N :   < 2@  &@㿘N -   +" ’   @ &@㿘N J M&@ `+ 2!N &@ `   "1 N .! ` w  "% N . `   ?Ѐ   &@` !m` 2N  / u` &`㿘 `@]* d2  @]$!2  "  " *` * "@*`" * ~;{Tx!*` * "@*`" * p ?",* * @*` * "@*`" *  @  @\ْ   $  &@@l d@\̒ d. * * ? @lޒ     < @``: @.`"@ @\  &` ,   *`, * @   6+  +  * "@*`" * @@posixrules`  @u!'w&(5?N '֒İ ",?!( 2&@N  [& (?N  , ;  2N ?Đ1'N , ;2iN ఒ "?N , Ȱ "?N ? &` &` &gL &gP&gTĐ &g`&gd&gh`eؤ ' #@İ$ $$ .$ . .$ .` @[ d2  @[!.  . *` * "@*`" * `gȤ~ ?   0gL gL) ` @ %ؑ* * @gP   @   ` @ %ؑ* * @gP ۘ  @  + eؑ* * @ S*e\ * + X + @"@ @Ē"@ @ " * * @'L'P     `Ւ@ Đ &gL&gP&gT &g` &gd&gh  &` &`&`Đ &gL&gP&gT &` &` ` "?#L@@ u@.@ `@ l.@ 㿘! `ג  ` 㿘4b ?"b !%Ē @  @pTZ㿘@q"࢒ 4" 4!@,D 5!4@t (  $"4!@L@ %`@"`@" "'L"'T+#@t``0!% @ L@ : @X % @'㿐'% @`  `  gP $*`  * * @'P 2* ` *@ @ * %ד*@ *`gL@ @ @K & _ℕ* cL @"   @&(㿘i 14##㿘4b 2 "b,4#,@`_"x3"h&(㿘 14##㿘14ؔ##㿘  L!L!P* @&>2> 4  * @ &$*  *   @ @2!L * `   *   @ *#T@ja@Ya&@T! T! ?"T! @i.&@YҒ.@i <&@Y˒ <&@Yƒ  & &'#@ @Y d2  @Y!,  , /@i!m?&* @*`@*`?@ < ?@i d$@i!,< @i d$@i!$$&&, @*`"@&*  $  &* 6& & &$㿘ې@@"&  2` 㿘@ &: @i`@i\: @g@"@&@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' (  '̒ < 29?В < 22?Ԓ  2+?ܒ 2$?'l 2?Ԁ )!n#@}? ؀`4    @X d2  @X!,  , @@`'Ԁ!n*#@؀`4    @X d2  @X!,  , @"@'Ԑ8  Ԁ!n"إ* ܀  @Xz d2  @Xt!,` ,`* Ԁ"'ؐ  ''ؐ   ?8 2?ܐ'l'Ȑ?ŀ 2?Ȑ ; ' p'n''Ƞ '  @Ȓ  ? `?',@" ',@ '耢`D A@,% @#`?,K?/ * @'P耢@2*?`? %/ * @, * @P耢@L L" '@Ȁ 2?耢@?, ?Б/ ?&  5 @ ''@ &?㿘   㿐`  $`  T` &$`  @,% @#? C?,* 'P` @27? 2,* , * P` @"$?L'L" @ $@` `?$`  , * 'L'L"@@" $@` `?$` ?֑, Ñ,?㿘*` 㿘?" 㿘" ah 㿘" ah|%@ @L( `( 㿘'DDD&㿐'DސDD 'ِ"@D@ 'ΐ"@D@& ??'"@D@4  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈`  X`* @ @`  X`* @ -@`#\@#``'l#d14#0``` @`#0$OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @(  @*(`$OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $H" @ J2  @*(` $OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@o @l" @n0 㿘e   -+ L L0 L x XL 0  >??J78 ??@S    #e`  ` А  . ɐ' "8?2 @  @  ??? " &〖J/> <@ F ɦ ``` '@㿘'He @  ` - + M@@ M@` 0 M@ x XM``  0  '% '?%>H F $ %D    9e78 "     ?А  T ?ɐ?M H$4?  @  ?31 `1&〖I> = @ f% @?2 @  @  ?3?1#c &〖If> = @ F @`H  H#㿘`&`` ` 2 @@a 8 "c'?@`" `@ @b͐ ? `?&`@* &@``@`  @b ?@`#?7"7'`''''@G`*@'L'P'T'X?7"7''#''@GL*@㿘 @? @̖$: x N  8'@m͐$ !' '8#5@ƒa@m$$  !$ $ ؔ$ : @(㿀@m'''' '@P$OpenBSD: clnt_tcp.c,v 1.15 1997/09/22 05:11:06 millert Exp $clnttcp_create: out of memory `@i d@i d 2 d"@Fc8`8 "`88#}" 2@g *` 26 @i0t 6"$`  @ &@[  @   8`8 "`88#"?O`@l;K`$`$@$` $`$` $` $` $` @; @4`L''Đ '''А`0 @, @\ 2 `P` $`@l ``L @$`H`P ``L@`L!@`(` $@_$$ `@i @i h'H'L'P\`L`0`  @&``&`  2  @2 `"$ $&`$?&  `0`H "`$  €H "`$ `€ LP  `$  &`$@5 m`$@1  2@b   `   &`$W$-8#Ǩ '`'`'''@ʐ C@Ȁ 2`$ 09@`$`$ 2$ `€Ԁ  &`$  &`(  `$ ؐ &`$؀  $@`$" `$ ` @ 2i$`$ $"@("`,"`㿘  " L L@` `` 0 0    "  """" "  㿘   " P@j P `@ L@h@h}P2 ! 4 * @hD ? ؐ  @k+8@:  ' 'Ш"@2`* ` * @  $@    @c@:y Ȕ"@'̒"@`'Đ'@'"@'Ē"@`''@'' '?`? ?  @& $@h+?c " & $@& (@h?؀@"@g@j  2 6& ( & $?8#& ( & $㿘#8 @i?$c& (& $? @$OpenBSD: clnt_perror.c,v 1.8 1997/02/10 00:51:39 millert Exp $㿘15" 5@g!&"5"%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u 㿈̠ w   €@!@0ז@jԐ耢`W@"*` |||dd||<||||||||$@!$@ @0< $@!"@ 1@$@!&@ @0@@j  @$@&@ P@0 $@!"@ X@0 $@!"@ $@!"@ @0s . . 㿘d"@CaP`@ `@ RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) "* 㿘d"@BaP%s: %s - %s %s: %s 㿘 85  8 8  2"8Ԑ `!@/ 8 8 8@  !@/{   8!@/p . . %s㿘d"@BchH(Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  Ї* $OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $㿘@8 `@ @ג` @Ғ`  ``  @7`Ѐ   ` l` p#` #d #h #l 8t8x?` d8t*`  2 ` ` @ *`#㻐 $@$ @?@>* 4 `@9* 2  ` @ /   ܤ 㻐 ! # !?@g$ @@ * 4 `@* `2 "  h'D'H'8!p @;?"?'8!p  H"$''''̴ < 8!lЀ8!h   @6լ%`78.`8!x@'-@@`l $Ȱ `lDH ͑* 8L`TP   )4? `Ȁ ` `!h2 `  @  @ $`&@ $  `"!h J@ސ''D'H'`@"H@ 【 7`@fzޠ  ސ"7ޑ*   @o 6-̀* @g'-@@?* 2 ' 77ްހ *`@fL2  ސ"7ޔ*   @?`! "%"""`@f* ސ"7ޑ*  @` `!h " `!h  @  @ $`` d ``d`d  `@x  #` d`DH@ Ֆ Hd   /'7`@b ` d&`DH @ؚ H 8-@@h*'@] '耢 $''` 2 @@&  x`2 * -@  @ &    @@cy   `0`2&〆 \'А '` @؀ P' '@` $ ( ` (2 DH @ / `    2  -@@d@!` "C`   " @V'q-@Ȁ  `!`@F`p " #`pDH /* `P   )4"? ` @3.` &' @Ȁ 8Ѐ8 ="c <"c"#?㿘!`!`  @e/?$!``"!d`"!h 㿘.`` .2  ,`2 . @[Q2`@L,4 . 2`@[G @L ,`6 㿘@-a #5b0$b0%5?# '@K͒4 5,4 @-P2""$b05 ? 2&2`  @ 52b$#5b&@K *   4b&@-3#5$b0@Kc4 `&$b0  ,2 , 2`@K *   * 2  (, , 2  , 2  @L(c` , 2`{52b(`2!x!5"4@4k 5"4 "b,`z  ` ? 2z㿘!5"4@4W `!x!/@5"4",@!5s!5"0 5@,$"05b0 2 "b0`!x@!/@ ]4`#5)5'5%"$@Zb & @KВ 4b `ax2ax55"(b 5b"`!z. 6 /&fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserversortlistoptionsconfRES_OPTIONSenv㻈 8ah "ah8!h` 8 "`8!h` 8""`8!h$ , 54 $ d<*@ $d$``h@ @c 2C@a p <`@| ,_`$D L`H8!Ā :N   `. " $    N ꀤ * : " . N   ` .$ @` 8# `@8 //8!8!h3@/ #@c,@U` 2.O `@d=  *O  $אON "  " N "ɐ Ɛ@ ,_@#` 2. `@d  BO  < 8# @1 N   L y b f@ *a  , `L y b f2  @ *a` "`Ѱ q`@cǔ  YO  SaON "  " N "S PȒ@z ,_@[ 2.&? MȀ?8!Ā :N  `. " $   N 퀤 * : " . N  ` .$ `@ci ,O  &`#ON "  " N " @:쀢 -`@"` *` 52```@c8  qO  k Ѱ)eN "  " * :  €  ; *```@̓:` 2NN`;`  @  2N N N.@耢 /,"!h``@ ,.  N  ;   " N.@˒耢 , "!l,!h'@ݐ$!l .l`@b”  eO  _@v`Y`88"!th *`d* "d@o8!hL`` @  @M . `` @b ,a_*8! "! $   *`:  .d N 8!Ȑ?8!` @" . $  $@ak 8!h @  " @_! @a8ah` "` ndots:debuginet6㿘 J8!h#*`: N "  " c@b)  @1  4!d* !d < $!dc@b   c@b  2  $ * : " N N  ` N  0 ???㿘?     H  . \*`D?@@:??(@`@/ ,- `. `\2 (@@:)?(@`(@`<  ?! ?(   #&  ? `(@! 㿘@   @ 2` H "?@u  A:`?,  ` ` ?"@7* ?@$@`$@  ,  .\ $ "? >**,2$? $      ? * " ?  e`* P㿘C`3 ` & `?7?, .+ \" ֦ Ҥ< ` "&`." *   @ `Ѥ & ¦? .J( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘 N 2N ߀ ]`. `\ " N` `. J߀](J    (  ( ( ( 2 *@*`2 *@2 *`2 *`*`㿐@ ?㿈'e*:   p 0   N x X $ *:      @UK?`*:  `D  `+ ? . 􀤀8 $*: ` -e @  '$:` `+!*` PxD?#* ?# *`* @  * *` *` `2&@ %s: 㿘(!d"b@88 "@9Ld"@8ؒb%s: : %s 㿘8#(!d"b@88  "@90"@8b@Ȑd"@8c  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`* R 㿐@-  ?&㿈 ' ''  @_* ?? $x c<@$ c<@$b c<@$! c<@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@I " @  2  @s`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@  `@  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@- @$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘5@b@$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Д   @  `   " @  `   "  2  $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @\ 㿐 Z? @Q 0@" &  @@"& 0@Y & 0& & V @Y  3\@PĔ `@YS  ?@YK`2   6 &  C&&  & 2(" 6 &&   &  &  & & & 8 #L"`㿘'H'L'P'T'Xd"@@6TH㿐@ & @P  @+L! 66 6  6 & "& $#& ,#l& (#&    @Z $OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @Y "?& D& H 㿘 4@a 2F&@ @C| `$@&@  4 "$4$ Β P 2+&@D@[;$@;  @CW `$@ 2&@D@["$$&@D $OpenBSD: xdr_rec.c,v 1.5 1997/05/28 21:28:56 deraadt Exp $xdrrec_create: out of memory 㿘@XW D "d@$ <@$ @@@XI  $ d"@5a0$    $  @$ (a t& & $$ $  $ $ $  $  @$ $ $ $ ($ 0$ ,$ 4 $ 8㿐 `4 `,`0"  &@`4?"`4`,  "`,@%   &@ 㿘  &  @ & & @6 2  & @" 㿘    4   8 2 @j 󀦠  @@ @ 4"$ 4&㿘"    "@  @ZM  $ @ @ &$ @  2  㿘`   @Z  ?@  "  0 ?  "  ," &㿘 ?("   0! "  @  @ $  ,"  4 0@  (@  $ , 4" $ 4     " 40@"@  ,@0" "4@", 㿘 @WI @WG㿘 @ 4 " & 4 8 2  4@ 2 4   4  8 & 8 㿘 @ 4  $ 4 8 2  4@ 2 4  4  8  , 0`?㿘`   2 "  *" @  " ?  "" " 㿘`@? @  " ?"@  "  2  &  &  㿘 ( 0   $ " ?" & ,& 0 㿘$  0 ,@   4 ,@Y ,& ,@&㿐ߔ   2 & 8 *@& 4  㿘`$  0 ,@ @ `  4 ,@& ,&@  c(/  ?$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@ @  "B @ 2: @NҒ @   ' @U  &@d"@2bp  @Y : @  @ @ @U@&@㿘 :     @ 㿘 @  $OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ $OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘5 #D?@?  0,@O  4?@?  0,libcUnknown error: 㿘!8@ a!. ἐ @ @ .` ?@@@ .`@XԐ "@@ʐ$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘e @  ` - + L@@ L@` 0 L@ x XL`` ` 0  `' #@?@O` $ %  3e/8 "`  ` ?А  2 ?ɐ?+&`&?  ?1 %〤 @M&?  ?#%〤 @Ms @Ţ` 'NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@V 2 @U& 2 @U Ф  !آ `*`:  :[ %O  ?* :  (F* |J@ :  @*`J@ :  @*`:  * L  *@?2 L 2 L ?0@&5 ?*@N "#\@Vl"?  ̔  @V՘@V`?2???#@ @SȐ  && @V̰?㿘8 <  5 @4-@08((@ @@@08((Ѐ66׺ո㿘? 8 "c ?" @U @S $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $8 x`H(p`P8p`8 x`@(pP@(x`8x`H8 `H(Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @((`  (02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $J H2 @ @((`($OpenBSD: pmap_getport.c,v 1.6 1997/09/22 05:11:08 millert Exp $p7ڐ?'ܐ o6 a!!'`'!#\ab @|! /a''''!!'`' #\ Ș ڀ  88 "8  €`  ڀ 2 8 "`8  @܀?"6 @R6 ځ$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@ْ @Ԓ`  @ϒ` @ʒ`  $OpenBSD: clnt_udp.c,v 1.15 1998/03/01 10:05:33 deraadt Exp $clntudp_create: out of memory X\@Oސ  `d"@,c`b8` `d@Oΐ@  ``d"@,c`R8$ X@"!    aE *` Va6 !$$$  $  $  $  $ $ $ ?$ $$ ($ T@$ \''Đ '''в 8 X@) @Y -  < @$ P 6$  ' @Ĕ   '8`8 "`88#"@  b~@Qє $ @W$$  @O @O| 㿈''b`#\b'D'H\`(? @'P``$'P`('T@! 4 * @O%   ؐ  @R'|'x`8&`8 €`P`X@ 2@ €H D `€ ƀ 2 ؀̐ @OȐ  @@`X `@>` 8#&`0؀ @O P 8T  8؀ @N ##'`'`'''p@! Ш"??/!#8 @2`* ` *   $ @   @`?& 2^'Lx`@'`|` @@'d'`@'d`'xd'|P@xT@Z @NV c Mh@ ֒ hp"@'`lt"@`'d'`А"@@'dx`@'X|d@@'\'X@'\X'x\'|P@xT@&@  @Nl @```\ @L c "'Lc #"~@&`0@NQ &`,N(s@`X``@2m@``@ @ƒ +@8`,`, D `€  &`, &`0  $@KD ` @  զ`8 '@'&`,؀"`,@N`, ,"@0"`4"`㿘  " 8 8@* Ą$(8L`t" $" ( $" ("" "  "  " " " " "   㿘   " <@P < `@ 8@M@M$OpenBSD: bindresvport.c,v 1.9 1996/09/15 09:31:30 tholo Exp $x ` '` 8 ."cD? @P/ .``  'ܐ  @ܰ , 'ؐ  @  "@` #8  c  @  &$c0 耦@ @䀢 8"#$OpenBSD: auth_none.c,v 1.3 1996/08/19 08:31:20 tholo Exp $㿀5#P 2  < @)Œ @ 5/ "#P < *8##& `& `&  & &  & a"&  ( @~ @5@2   @& <  `@㿘5#P (` <   $a c<@$i c<@$ c<@$] c<@$ c<@$v c<@$  c<@$h c<@$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"aTa4" " " "   "  "@ "     "  @  "   " +dd ( ( (d"@ "   #"@#d d*d* * *  "   #㿘 "  &  @N &   㿘 "  &  @N &       @  @4 " "     @  $OpenBSD: rpc_prot.c,v 1.6 1998/03/19 00:27:21 millert Exp $㿘@  ``@Ė!㿘@ 㿘 @n` " `    `€` @y`  @r`㿘@M " @   @]`  @X`@6` 㿘@K @(` " ` 2  `` a|@  㿘&` &` 2 @( @` @`  @` @`  Ƅ* @(4 "@ "@ "@  "@ "@"@ "@"`"`   "@ "@ "@ "`"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr.c,v 1.5 1998/03/19 00:27:27 millert Exp $㿀 ' 㿐 "    0@'  € € &@  㿐 "    0@'  € € &@  㿘      0    € 㿘      0    € 㿐 "    0@'  € € &@  㿐 "    0@'  € € &@  㿐 "    0V@'  € € 6@